IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The crystal structure of the exon junction complex reveals how it maintains a stable grip on mRNA. The crystal structure of the exon junction complex reveals how it maintains a stable grip on mRNA. Cell (0092-8674) 2006 imex curation Bono F., Ebert J., Lorentzen E., Conti E. conti@embl.de 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions 2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bono F., Ebert J., Lorentzen E., Conti E. conti@embl.de Accepted 2006-OCT-13 by DAVET. Cell (0092-8674) 2006 Only protein-protein interactions 2 imex curation mgn_human Protein mago nashi homolog MAGOH MAGOHA protein protein human Homo sapiens Human MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI DIP protein P61326 original sequence version: 113 DIP protein P61326 original sequence version: 114 DIP protein P61326 original sequence version: 78 DIP protein P61326 original sequence version: 91 DIP protein P61326 original sequence version: 100 FFAD0B075E045875 casc3_human Protein CASC3 CASC3 MLN51 Cancer susceptibility candidate gene 3 protein Metastatic lymph node gene 51 protein Protein barentsz protein protein human Homo sapiens Human MADRRRQRASQDTEDEESGASGSDSGGSPLRGGGSCSGSAGGGGSGSLPSQRGGRTGALHLRRVESGGAKSAEESECESEDGIEGDAVLSDYESAEDSEGEEGEYSEEENSKVELKSEANDAVNSSTKEEKGEEKPDTKSTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALYGYDIRSAHNPDDIKPRRIRKPRYGSPPQRDPNWNGERLNKSHRHQGLGGTLPPRTFINRNAAGTGRMSAPRNYSRSGGFKEGRAGFRPVEAGGQHGGRSGETVKHEISYRSRRLEQTSVRDPSPEADAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKLAEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLNIAEQNWSPGQPSFLQPRELRGMPNHIHMGAGPPPQFNRMEEMGVQGGRAKRYSSQRQRPVPEPPAPPVHISIMEGHYYDPLQFQGPIYTHGDSPAPLPPQGMLVQPGMNLPHPGLHPHQTPAPLPNPGLYPPPVSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS DIP protein O15234 original sequence version: 129 DIP protein O15234 original sequence version: 130 DIP protein O15234 original sequence version: 94 DIP protein O15234 original sequence version: 106 DIP protein O15234 original sequence version: 114 642A4C01C8DD3BE0 rbm8a_human RNA-binding protein 8A HSPC114 MDS014 RNA-binding motif protein 8A Ribonucleoprotein RBM8A RNA-binding protein Y14 Binder of OVCA1-1 RBM8A RBM8 protein protein human Homo sapiens Human MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR 70BBD03CDDFEECFE if4a3_human Eukaryotic initiation factor 4A-III KIAA0111 EIF4A3 DDX48 Eukaryotic translation initiation factor 4A isoform 3 ATP-dependent RNA helicase eIF4A-3 ATP-dependent RNA helicase DDX48 DEAD box protein 48 Eukaryotic initiation factor 4A-like NUK-34 Nuclear matrix protein 265 protein protein human Homo sapiens Human MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI DIP protein P38919 original sequence version: 160 DIP protein P38919 original sequence version: 161 DIP protein P38919 original sequence version: 124 DIP protein P38919 original sequence version: 137 DIP protein P38919 original sequence version: 157 DIP protein P38919 original sequence version: 146 DIP protein P38919 original sequence version: 151 3A21888CA96CA5EA casc3-ddx48 1 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 2 unspecified role unspecified role neutral component neutral component c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 5 unspecified role unspecified role neutral component neutral component c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association Note this complex also contains a nonhydrolysable ATP analog (AMPPNP) and U15 RNA. Crystals that diffract to 3.2A� resolution were obtained with the complex of Mago (full length), Y14 (residues 66�174, referred to as Y14DN), eIF4AIII (full length), Btz (the SELOR domain, residues 137�286, Degot et al., 2004), a nonhydrolyzable ATP analog (AMPPNP), and U15 RNA. A crystal form that diffracts to 2.2A� resolution was obtained by reconstituting the EJC with a Y14 construct that also lacks the low-complexity C terminal region (Y14DCDN, residues 66�154) 2, Table 1 2.2 A Rfree(%) 21.9; Rwork(%) 18.8 casc3-ddx48-1 1 5 unspecified role unspecified role neutral component neutral component c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association To determine the structure of the eIF4AIII-Btz subcomplex, we used an eIF4AIII construct (residues 38�411) lacking the N-terminal sequence that flanks the helicase domains and a Btz construct trimmed to residues 137�250. The structure is refined at 3.0 A � resolution to an Rfree of 32.5% and R factor of 27.1%. 5, Table 1 The structure of the helicase in eIF4AIII-Btz reveals is very different from the conformation observed in the EJC. 3.0 A Rfree(%) 32.5; Rwork(%) 27.1