MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Regulation of antiviral responses by a direct and specific interaction between TRAF3 and Cardif. Regulation of antiviral responses by a direct and specific interaction between TRAF3 and Cardif. EMBO J. (0261-4189) 2006 imex curation Saha SK., Pietras EM., He JQ., Kang JR., Liu SY., Oganesyan G., Shahangian A., Zarnegar B., Shiba TL., Wang Y., Cheng G. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Saha SK., Pietras EM., He JQ., Kang JR., Liu SY., Oganesyan G., Shahangian A., Zarnegar B., Shiba TL., Wang Y., Cheng G. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Regulation of antiviral responses by a direct and specific interaction between TRAF3 and Cardif. Regulation of antiviral responses by a direct and specific interaction between TRAF3 and Cardif. EMBO J. (0261-4189) 2006 imex curation Saha SK., Pietras EM., He JQ., Kang JR., Liu SY., Oganesyan G., Shahangian A., Zarnegar B., Shiba TL., Wang Y., Cheng G. 2009-01-08 Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Saha SK., Pietras EM., He JQ., Kang JR., Liu SY., Oganesyan G., Shahangian A., Zarnegar B., Shiba TL., Wang Y., Cheng G. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Regulation of antiviral responses by a direct and specific interaction between TRAF3 and Cardif. Regulation of antiviral responses by a direct and specific interaction between TRAF3 and Cardif. EMBO J. (0261-4189) 2006 imex curation Saha SK., Pietras EM., He JQ., Kang JR., Liu SY., Oganesyan G., Shahangian A., Zarnegar B., Shiba TL., Wang Y., Cheng G. 2009-01-08 Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Saha SK., Pietras EM., He JQ., Kang JR., Liu SY., Oganesyan G., Shahangian A., Zarnegar B., Shiba TL., Wang Y., Cheng G. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation mavs_mouse Mitochondrial antiviral-signaling protein Mavs Ips1 Visa CARD adapter inducing interferon beta Interferon beta promoter stimulator protein 1 Virus-induced-signaling adapter protein protein mouse Mus musculus Mouse MTFAEDKTYKYIRDNHSKFCCVDVLEILPYLSCLTASDQDRLRASYRQIGNRDTLWGLFNNLQRRPGWVEVFIRALQICELPGLADQVTRVYQSYLPPGTSLRSLEPLQLPDFPAAVSGPSAFAPGHNIPDHGLRETPSCPKPVQDTQPPESPVENSEQLLQTNSGAVARMSGGSLIPSPNQQALSPQPSREHQEQEPELGGAHAANVASVPIATYGPVSPTVSFQPLPRTALRTNLLSGVTVSALSADTSLSSSSTGSAFAKGAGDQAKAATCFSTTLTNSVTTSSVPSPRLVPVKTMSSKLPLSSKSTAAMTSTVLTNTAPSKLPSNSVYAGTVPSRVPASVAKAPANTIPPERNSKQAKETPEGPATKVTTGGNQTGPNSSIRSLHSGPEMSKPGVLVSQLDEPFSACSVDLAISPSSSLVSEPNHGPEENEYSSFRIQVDESPSADLLGSPEPLATQQPQEEEEHCASSMPWAKWLGATSALLAVFLAVMLYRSRRLAQ DIP protein Q8VCF0 original sequence version: 119 traf3_mouse TNF receptor-associated factor 3 CD40 receptor-associated factor 1 TRAFAMN Traf3 Craf1 Trafamn RING-type E3 ubiquitin transferase TRAF3 protein protein mouse Mus musculus Mouse MESSKKMDAAGTLQPNPPLKLQPDRGAGSVLVPEQGGYKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP DIP protein Q60803 original sequence version: 127 DIP protein Q60803 original sequence version: 129 DIP protein Q60803 original sequence version: 117 DIP protein Q60803 original sequence version: 121 EC282EFFF84E5A3F mavs_rat Mitochondrial antiviral-signaling protein Mavs Ips1 Visa Virus-induced-signaling adapter Interferon beta promoter stimulator protein 1 protein protein rat Rattus norvegicus (Rat) Rat MTFAEEKTYKYIRYNHSKFCCVDVLEILPYLSCLTTSDQDRLRASYKQLGNQGTLWELFNTLQRRPGWVEVFIRALRICELPGLAEQVTRVYQSYLPPGASLHSLDPLQSPRIPTTVSEPSAFAAGHTIPDSGFQDKPGYPKPVQDTQPPKSPVENSEEPPQANFGAIPRMSGDSLISSPNPPALSPQPSREHPEQEPELGGPSTANVDSVPIATYGPVSPTVSFQPLPRIAPRTNLSPGVTVSALSAKTTLSSSSTGSAFAKGAGDQAKAATCVSTKEGVPTNSVTTSSVPSIKPVPVNTMSSKLPISTKSTAATPSTVPTNIAPSKLPINSVYTGIVPSKVTASVAKASASTMPPERNNKQAKETLEAPATVVTTGSSLTRPDISSRSLHSGPELSKPGVLVSQVDNEPFSACSMDLAISPSTSLGSEPNHGPEENEYSSFRIQVDKSPSVDLLGSPEPLATQQSPEEEEPCASSVSWAKWLGATSALLAAFLAVMLYRSRHLAQ mint Required for innate immune defense against viruses. Acts downstream of DDX58 and IFIH1/MDA5, which detect intracellular dsRNA produced during viral replication, to coordinate pathways leading to the activation of NF-kappa-B, IRF3 and IRF7, and to the subsequent induction of antiviral cytokines such as IFN-beta and RANTES (CCL5). May activate the same pathways following detection of extracellular dsRNA by TLR3. May protect cells from apoptosis D2924B1E34CADE47 traf3-mavs 2 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2839994: original sequence: 78-473 : ICELPGLADQVTRVYQSYLPPGTSLRSLEPLQLPDFPAAVSGPSAFAPGHNIPDHGLRETPSCPKPVQDTQPPESPVENSEQLLQTNSGAVARMSGGSLIPSPNQQALSPQPSREHQEQEPELGGAHAANVASVPIATYGPVSPTVSFQPLPRTALRTNLLSGVTVSALSADTSLSSSSTGSAFAKGAGDQAKAATCFSTTLTNSVTTSSVPSPRLVPVKTMSSKLPLSSKSTAAMTSTVLTNTAPSKLPSNSVYAGTVPSRVPASVAKAPANTIPPERNSKQAKETPEGPATKVTTGGNQTGPNSSIRSLHSGPEMSKPGVLVSQLDEPFSACSVDLAISPSSSLVSEPNHGPEENEYSSFRIQVDESPSADLLGSPEPLATQQPQEEEEHCAS Stoichiometry: 1.0 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association F4B EMBO-Journal homomint mint mavs-traf3 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8VCF0:p.Thr147Ile mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T I Tue Jul 12 10:08:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:26:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr147ile' Tue Jun 30 19:59:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr147Ile' range MINT-2840026: original sequence: 147-147 : TPSCPKPVQDTQPPESPVEN binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain TIM range MINT-2839999: original sequence: 138-158 : PSCPKPVQDTQPPESPVENS Stoichiometry: 1.0 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate Stoichiometry: 1.0 physical association physical association F5A EMBO-Journal homomint mint mavs-traf3-1 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain TIM range MINT-2840051: original sequence: 138-158 : PSCPKPVQDTQPPESPVENS gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5B EMBO-Journal homomint mint mavs-traf3-2 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate Q60803:p.Tyr440Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:06:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:56:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr440ala' Tue Jun 30 19:29:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr440Ala' range MINT-2841701: original sequence: 440-440 : EAVMGKTLSLYSQPFYTGYF Q60803:p.Gln442Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A Tue Jul 12 10:06:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:31:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln442ala' Tue Jun 30 17:00:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln442Ala' range MINT-2841704: original sequence: 442-442 : VMGKTLSLYSQPFYTGYFGY Stoichiometry: 1.0 physical association physical association F6A EMBO-Journal homomint mint traf3-mavs-1 3 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F4C EMBO-Journal Traf3 mouse Up_Id was used instead of Traf3 Rat homomint mint