MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Unique anti-apoptotic activity of EAAC1 in injured motor neurons. Unique anti-apoptotic activity of EAAC1 in injured motor neurons. EMBO J. (0261-4189) 2006 imex curation Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. 2009-01-08 Only protein-protein interactions rat-motor_neuron Rat motor neuon motor_neuron motor neuron anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Unique anti-apoptotic activity of EAAC1 in injured motor neurons. Unique anti-apoptotic activity of EAAC1 in injured motor neurons. EMBO J. (0261-4189) 2006 imex curation Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. 2009-01-08 Only protein-protein interactions in vitro In vitro competition binding competition binding nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Unique anti-apoptotic activity of EAAC1 in injured motor neurons. Unique anti-apoptotic activity of EAAC1 in injured motor neurons. EMBO J. (0261-4189) 2006 imex curation Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. 2009-01-08 Only protein-protein interactions mouse-motor_neuron Mouse motor neuron motor_neuron motor neuron anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Unique anti-apoptotic activity of EAAC1 in injured motor neurons. Unique anti-apoptotic activity of EAAC1 in injured motor neurons. EMBO J. (0261-4189) 2006 imex curation Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. 2009-01-08 Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Unique anti-apoptotic activity of EAAC1 in injured motor neurons. Unique anti-apoptotic activity of EAAC1 in injured motor neurons. EMBO J. (0261-4189) 2006 imex curation Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Unique anti-apoptotic activity of EAAC1 in injured motor neurons. Unique anti-apoptotic activity of EAAC1 in injured motor neurons. EMBO J. (0261-4189) 2006 imex curation Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. 2009-01-08 Only protein-protein interactions rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Unique anti-apoptotic activity of EAAC1 in injured motor neurons. Unique anti-apoptotic activity of EAAC1 in injured motor neurons. EMBO J. (0261-4189) 2006 imex curation Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. 2009-01-08 Only protein-protein interactions rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Unique anti-apoptotic activity of EAAC1 in injured motor neurons. Unique anti-apoptotic activity of EAAC1 in injured motor neurons. EMBO J. (0261-4189) 2006 imex curation Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kiryu-Seo S., Gamo K., Tachibana T., Tanaka K., Kiyama H. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation xiap_rat E3 ubiquitin-protein ligase XIAP Api3 Baculoviral IAP repeat-containing protein 4 Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP homolog A Xiap Birc4 RING-type E3 ubiquitin transferase XIAP protein protein rat Rattus norvegicus (Rat) Rat MTFNSFEGSRTVVPADTNKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDTVQCFSCHAAVDRWQYGDSAVGRHRRISPNCRFINGFYFENGATQSTSPGIQNGQYKSENCVGNRNHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKTFQNWPDYAHLSPRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYDARIVTFGTWLYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLGESVVRTAEKTPSVTKKIDDTIFQNPMVQEAIRMGFNFKDIKKTMEEKLQTSGSNYLSLEVLIADLVSAQKDNSQDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCCTVITFKQKIFMS mint Apoptotic suppressor. Has E3 ubiquitin-protein ligase activity. Mediates the proteasomal degradation of target proteins, such as caspase-3, SMAC or AIFM1. Inhibitor of caspase-3, -7 and -9. Mediates activation of MAP3K7/TAK1, leading to the activation of NF-kappa-B E250E3C77461A469 cchl_mouse Holocytochrome c-type synthase Cytochrome c-type heme lyase Hccs Cchl protein protein mouse Mus musculus Mouse MGASASSPATAVNASNASDGQPASPPSGCPMHKGQRKGCPVTAATSDLTSESKAHTVPAHQDRAYDYVECPVTGARAKDKESLDPSNLMPPPNQTPSPDQPFTLSTSREESSIPRADSEKKWVYPSEQMFWNAMLRKGWKWKDDDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAHECPCGPSLVRFGGKAREYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKEYQFTILDVRPAFDSFSAVWDRMKVAWWRWTS Links covalently the heme group to the apoprotein of cytochrome c mint AAAD63DBB3F81E47 eaa3_rat Excitatory amino acid transporter 3 Slc1a1 Eaac1 Eaat3 Sodium-dependent glutamate/aspartate transporter 3 Excitatory amino-acid carrier 1 Solute carrier family 1 member 1 protein protein rat Rattus norvegicus (Rat) Rat MGKPTSSGCDWRRFLRNHWLLLSTVAAVVLGIVVGVLVRGHSELSNLDKFYFAFPGEILMRMLKLVILPLIISSMITGVAALDSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGVTQKVNEINRTGKTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPASDPGGNQTEVSVTTAMTTMSENKTKEYKIVGLYSDGINVLGLIIFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPIGILFLIAGKIIEVEDWEIFRKLGLYMATVLSGLAIHSLVVLPLIYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNHVDKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNGMDLSIGQIITISITATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQVDVSSEVNIVNPFALEPTILDNEDSDTKKSYVNGGFSVDKSDTISFTQTSQF mint Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium. Negatively regulated by ARL6IP5 D6783244E37640E4 eaa3_mouse Excitatory amino acid transporter 3 Slc1a1 Eaac1 Eaat3 Sodium-dependent glutamate/aspartate transporter 3 Excitatory amino-acid carrier 1 Solute carrier family 1 member 1 protein protein mouse Mus musculus Mouse MGKPTSSGCDWRRFLRNHWLLLSTVAAVVLGIVLGVVVRGHSELSNLDKFYFAFPGEILMRMLKLVILPLIVSSMITGVAALDSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGVTQKVNDINRTGKTPEVSTMDAMLDLIRNMFPENLVQACFQQYKTKREEVKPVGDPGGNATEVSVTTAMTTMSENKTKEYKIVGLYSDGINVLGLIIFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPIGILFLIAGKIIEVEDWEIFRKLGLYMATVLSGLAIHSLIVLPLLYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNQVDKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVNPFALEPTTLDNEDSDTKKSYVNGGFAVDKSDTISFTQTSQF mint Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium. Negatively regulated by ARL6IP5 46F35480465E5A82 birc3_mouse Baculoviral IAP repeat-containing protein 3 Inhibitor of apoptosis protein 1 Birc3 RING-type E3 ubiquitin transferase BIRC3 Cellular inhibitor of apoptosis 2 protein protein mouse Mus musculus Mouse MVQDSAFLAKLMKSADTFELKYDFSCELYRLSTYSAFPRGVPVSERSLARAGFYYTGANDKVKCFCCGLMLDNWKQGDSPMEKHRKLYPSCNFVQTLNPANSLEASPRPSLPSTAMSTMPLSFASSENTGYFSGSYSSFPSDPVNFRANQDCPALSTSPYHFAMNTEKARLLTYETWPLSFLSPAKLAKAGFYYIGPGDRVACFACDGKLSNWERKDDAMSEHQRHFPSCPFLKDLGQSASRYTVSNLSMQTHAARIRTFSNWPSSALVHSQELASAGFYYTGHSDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYLLRIKGQEFVSQVQAGYPHLLEQLLSTSDSPEDENADAAIVHFGPGESSEDVVMMSTPVVKAALEMGFSRSLVRQTVQWQILATGENYRTVSDLVIGLLDAEDEMREEQMEQAAEEEESDDLALIRKNKMVLFQHLTCVTPMLYCLLSARAITEQECNAVKQKPHTLQASTLIDTVLAKGNTAATSFRNSLREIDPALYRDIFVQQDIRSLPTDDIAALPMEEQLRKLQEERMCKVCMDREVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVRTFLS DIP protein O08863 original sequence version: 109 2EC9C7B567721382 xm_001065465 XM_001065465 protein protein rat Rattus norvegicus (Rat) Rat mint xiap_mouse E3 ubiquitin-protein ligase XIAP Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP homolog A Xiap Aipa Api3 Miha Birc4 Baculoviral IAP repeat-containing protein 4 RING-type E3 ubiquitin transferase XIAP protein protein mouse Mus musculus Mouse MTFNSFEGTRTFVLADTNKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDTVQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFINGFYFENGAAQSTNPGIQNGQYKSENCVGNRNPFAPDRPPETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKSFQNWPDYAHLTPRELASAGLYYTGADDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYEARIVTFGTWTSSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRTAEKTPSLTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS DIP protein Q60989 original sequence version: 93 EE5D242D3C3DF12E birc2_mouse Baculoviral IAP repeat-containing protein 2 Inhibitor of apoptosis protein 2 Birc2 Cellular inhibitor of apoptosis 1 RING-type E3 ubiquitin transferase BIRC2 protein protein mouse Mus musculus Mouse MDKTVSQRLGQGTLHQKLKRIMEKSTILSNWTKESEEKMKFDFSCELYRMSTYSAFPRGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKQGDSPVEKHRQFYPSCSFVQTLLSASLQSPSKNMSPVKSRFAHSSPLERGGIHSNLCSSPLNSRAVEDFSSRMDPCSYAMSTEEARFLTYSMWPLSFLSPAELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPHCPFLENTSETQRFSISNLSMQTHSARLRTFLYWPPSVPVQPEQLASAGFYYVDRNDDVKCFCCDGGLRCWEPGDDPWIEHAKWFPRCEFLIRMKGQEFVDEIQARYPHLLEQLLSTSDTPGEENADPTETVVHFGPGESSEDVVMMSTPVVKAALEMGFSRSLVRQTVQRQILATGENYRTVNDIVSVLLNAEDERREEEKERQTEEMASGDLSLIRKNRMALFQQLTHVLPILDNLLEASVITKQEHDIIRQKTQIPLQARELIDTVLVKGNAAANIFKNSLKEIDSTLYENLFVEKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDREVSIVFIPCGHLVVCQECAPSLRKCPICRGTIKGTVRTFLS E08969D93C6C610D cyc_rat Cytochrome c, somatic Cycs protein protein rat Rattus norvegicus (Rat) Rat MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain mint B5BCA779BCE40492 xm_001065465.1 XM_001065465.1 protein protein rat Rattus norvegicus (Rat) Rat mint xm-slc1a1 6 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 14 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F5A EMBO-Journal mint xm-xiap 6 18 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F7A EMBO-Journal mint cycs-xm 7 18 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 17 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization F5B EMBO-Journal mint hccs-slc1a1 5 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:12:07 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 1-17 range MINT-2839586: original sequence: 1-17 : MGKPTSSGCDWRRFLR Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6B EMBO-Journal mint hccs-xiap 5 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 15 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association F7B EMBO-Journal mint xiap-hccs 5 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 15 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain BIR domain range MINT-2839822: original sequence: 124-142 : RNPFAPDRPPETHADYLL gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association EMBO-Journal F7F mint hccs-slc1a1-1 2 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2839612: original sequence: 1-17 : MGKPTSSGCDWRRFLR Stoichiometry: 1.0 direct interaction direct interaction F6C EMBO-Journal mint hccs-slc1a1-2 4 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2839558: original sequence: 148-272 : QKDMYNIIRIHNQNNEQAWKEILKWEALHAHECPCGPSLVRFGGKAREYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKEYQFTILDVRPAFDSFSAVWDRMKVAWWRWT flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6A F6D EMBO-Journal mint xiap-hccs-1 4 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2839706: original sequence: 148-272 : QKDMYNIIRIHNQNNEQAWKEILKWEALHAHECPCGPSLVRFGGKAREYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKEYQFTILDVRPAFDSFSAVWDRMKVAWWRWT ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 15 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F7C EMBO-Journal 7E 7G mint birc2-hccs 4 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 16 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F7C EMBO-Journal mint birc3-hccs 4 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F7C EMBO-Journal mint xiap-hccs-2 4 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 15 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F7C EMBO-Journal mint hccs-slc1a1-3 4 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 12 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association EMBO-Journal F7G mint slc1a1-hccs 8 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-2839874: original sequence: 1-34 : MGKPTSSGCDWRRFLRNHWLLLSTVAAVVLGIV tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association NFA EMBO-Journal see pag 3413 dx mint xm-slc1a1-1 1 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 18 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F8A EMBO-Journal mint xiap-hccs-3 3 10 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 15 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F8B EMBO-Journal mint