MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it PIASxbeta acts as an activator of Hoxb1 and is antagonized by Krox20 during hindbrain segmentation. PIASxbeta acts as an activator of Hoxb1 and is antagonized by Krox20 during hindbrain segmentation. EMBO J. (0261-4189) 2006 imex curation Garcia-Dominguez M., Gilardi-Hebenstreit P., Charnay P. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Garcia-Dominguez M., Gilardi-Hebenstreit P., Charnay P. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation PIASxbeta acts as an activator of Hoxb1 and is antagonized by Krox20 during hindbrain segmentation. PIASxbeta acts as an activator of Hoxb1 and is antagonized by Krox20 during hindbrain segmentation. EMBO J. (0261-4189) 2006 imex curation Garcia-Dominguez M., Gilardi-Hebenstreit P., Charnay P. 2009-01-08 Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Garcia-Dominguez M., Gilardi-Hebenstreit P., Charnay P. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation PIASxbeta acts as an activator of Hoxb1 and is antagonized by Krox20 during hindbrain segmentation. PIASxbeta acts as an activator of Hoxb1 and is antagonized by Krox20 during hindbrain segmentation. EMBO J. (0261-4189) 2006 imex curation Garcia-Dominguez M., Gilardi-Hebenstreit P., Charnay P. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Garcia-Dominguez M., Gilardi-Hebenstreit P., Charnay P. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation PIASxbeta acts as an activator of Hoxb1 and is antagonized by Krox20 during hindbrain segmentation. PIASxbeta acts as an activator of Hoxb1 and is antagonized by Krox20 during hindbrain segmentation. EMBO J. (0261-4189) 2006 imex curation Garcia-Dominguez M., Gilardi-Hebenstreit P., Charnay P. 2009-01-08 Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Garcia-Dominguez M., Gilardi-Hebenstreit P., Charnay P. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation nab1_mouse NGFI-A-binding protein 1 Nab1 EGR-1-binding protein 1 protein protein mouse Mus musculus Mouse MATALPRTLGELQLYRILQKANLLSYFDAFIQQGGDDVQQLCEAGEEEFLEIMALVGMASKPLHVRRLQKALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPTWLGISCNSYERSSSSREPHLKIPKCAATTCVQSLGQGKSEVGSLALQSVSDSRLWQGHHATESEHSLSPADLGSPASPKESSEALDAAAALSVAECVERMAPTLPKSDLSEVKELLKNNKKLAKMIGHIFEMSDEDPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAAAQLCVKDNALLTRRDELFALARQVSREVTYKYTYRTTRLKCGERDELSPKRIKIEDGFPDFQESVPTLFQQARAKSEELAGLGSQQAEKGMAKQMELLCAQAGYERLQQERRLTAGLYRQSSGEQSPDGGLPSDSSDGQGERPLNLRIPSVQNRQPHHFVVDGELSRLYSSEAKSHSSESLGILKDYPHSAFTLEKKVIKTEPEDSR mint Acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2 535CC2ADD604219C q8c5d8-1 E3 SUMO-protein ligase PIAS2 Pias2 Androgen receptor-interacting protein 3 DAB2-interacting protein Miz1 Msx-interacting zinc finger protein Piasx Protein inhibitor of activated STAT x Protein inhibitor of activated STAT2 RING-type E3 ubiquitin transferase PIAS2 Miz1 PIASx-beta protein protein mouse Mus musculus Mouse MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTLEGLCDLSTIKSSVFSLDGSSSPVEPDLPVAGIHSLPSTSITPHSPSSPVGSVLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRPKKEAMKVTSQPCTKVESSSVFSKPCSVTVASDASKKKIDVIDLTIESSSDEEEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPVSSMSSDLPGLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSETGVITSSGRNIPDIISLD mint E980B834C2A9C58E nab2_mouse NGFI-A-binding protein 2 Nab2 EGR-1-binding protein 2 protein protein mouse Mus musculus Mouse MHRAPSPTAEQPPGRGDNTRRTPQPRFKASAPAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGQSTPESDVGAGGEEEAGSPPFSPPAGGGVSEGPGVGGVAAGGAGGGPDRLEPEMVRMVVESVERIFRSFPRGDTGEIASLLKLNKKLARSVGHIFEMDDHDAQKEEEIRKYSVIYGRLDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQVARESTYLSSLKGSRLHSEELGGPPLKKLKQEVGEQSHNEIQQPPPGPESYAPPYRPSLEEDSASLSGESLDGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ 4FFA510C8E39DF70 par4_mouse Proteinase-activated receptor 4 F2rl3 Par4 Thrombin receptor-like 3 Coagulation factor II receptor-like 3 protein protein mouse Mus musculus Mouse MCWPLLYPLVLGLSISLAEGIQTPSIYDDVESTRGSHEGPLGPTVELKEPKSSDKPNPRGYPGKFCANDSDTLELPASSQALLLGWVPTRLVPALYGLVVAVGLPANGLALWVLATRVPRLPSTILLMNLAVADLLLALVLPPRLAYHLRGQRWPFGEAACRVATAALYGHMYGSVLLLAAVSLDRYLALVHPLRARALRGQRLTTGLCLVAWLSAATLALPLTLHRQTFRLAGSDRMLCHDALPLTEQTSHWRPAFICLAVLGCFVPLLAMGLCYGATLRALAANGQRYSHALRLTALVLFSAVASFTPSNVLLVLHYSNPSPEAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSHEFREKVRAMLCRQPEASSSSQASREAGSRGTAICSSTLL DIP protein O88634 original sequence version: 112 mint Receptor for activated thrombin or trypsin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation DC10502E7AAE1B86 egr2_mouse E3 SUMO-protein ligase EGR2 Egr2 Egr-2 Krox-20 Zfp-25 Zinc finger protein Krox-20 Early growth response protein 2 E3 SUMO-protein transferase ERG2 protein protein mouse Mus musculus Mouse MMTAKAVDKIPVTLSGFMHQLPDSLYPVEDLAASSVTIFPNGELGGPFDQMNGVAGDGMINIDMTGEKRPLDLPYPSSFAPISAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGILQGVTPPASTTASSSVTSASPNPLATGPLGVCTMSQTQPELDHLYSPPPPPPPYSGCTGDLYQDPSAFLSPPSTTSTSSLAYQPPPSYPSPKPAMDPGLIPMIPDYPGFFPSPCQRDPHGAAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPGAGVTGPGASGGGEGPRLPGSGSAAVTATPYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSAPPSAQSSASGPGGSQAGGSLCGNSAIGGPLASCTSRTRTP mint homomint Sequence-specific DNA-binding transcription factor. Binds to two specific DNA sites located in the promoter region of HOXA4. May play a role in the regulation of hindbrain segmentation, might act in combination with the Hox network to specify odd and even rhombomeres, and might participate in the control of the expression of some of the homeobox containing genes 67712733C77960F0 egr2-nab1 3 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2737109: original sequence: 184-470 : DPSAFLSPPSTTSTSSLAYQPPPSYPSPKPAMDPGLIPMIPDYPGFFPSPCQRDPHGAAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPGAGVTGPGASGGGEGPRLPGSGSAAVTATPYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSAPPSAQSSASGPGGSQAGGSLCGNSAIGGPLASCTSRTRT Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association NFA EMBO-Journal A total of 26 clones were finally retained at this stage and nucleotide sequence analysis of the cDNAs revealed that they corresponded to 12 different genes. Two of them corresponded to already known Krox20 cofactors, Nab1 and Nab2 (Russo et al, 1995; Svaren et al, 1996) (two and six clones, respectively), indicating that the two-hybrid selection was performed appropriately. homomint mint egr2-nab2-2 3 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2737115: original sequence: 184-470 : DPSAFLSPPSTTSTSSLAYQPPPSYPSPKPAMDPGLIPMIPDYPGFFPSPCQRDPHGAAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPGAGVTGPGASGGGEGPRLPGSGSAAVTATPYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSAPPSAQSSASGPGGSQAGGSLCGNSAIGGPLASCTSRTRT Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association NFA EMBO-Journal A total of 26 clones were finally retained at this stage and nucleotide sequence analysis of the cDNAs revealed that they corresponded to 12 different genes. Two of them corresponded to already known Krox20 cofactors, Nab1 and Nab2 (Russo et al, 1995; Svaren et al, 1996) (two and six clones, respectively), indicating that the two-hybrid selection was performed appropriately. homomint mint egr2-pias2 3 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain proline rich range MINT-2737481: original sequence: 133-162 : QQPSPPIPPVHPDVQLKNLPFYDVLDVLI Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:44:48 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Asp383Tyr range MINT-2737441: original sequence: 383-383 : MRNFSRSDHLTTHIRTHTGE undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:44:48 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Ser382Arg range MINT-2737438: original sequence: 382-382 : CMRNFSRSDHLTTHIRTHTG binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2737234: original sequence: 329-425 : KTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERK Stoichiometry: 1.0 physical association physical association F6 F1A F2D F2C EMBO-Journal Krox20 interacts with PIASxb homomint mint egr2-pias2-1 3 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain proline rich range MINT-2737488: original sequence: 133-162 : QQPSPPIPPVHPDVQLKNLPFYDVLDVLI Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:04:01 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Arg409Trp range MINT-2737499: original sequence: 409-409 : YCGRKFARSDERKRHTKIHL binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2737504: original sequence: 329-425 : KTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERK Stoichiometry: 1.0 physical association physical association F6 F1A F2D F2C EMBO-Journal Krox20 interacts with PIASxb homomint mint egr2-f2rl3 3 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:01:59 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Asp383Tyr range MINT-2828862: original sequence: 383-383 : MRNFSRSDHLTTHIRTHTGE binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2737722: original sequence: 184-470 : DPSAFLSPPSTTSTSSLAYQPPPSYPSPKPAMDPGLIPMIPDYPGFFPSPCQRDPHGAAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPGAGVTGPGASGGGEGPRLPGSGSAAVTATPYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSAPPSAQSSASGPGGSQAGGSLCGNSAIGGPLASCTSRTRT tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:02:06 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Ser382Arg range MINT-2828859: original sequence: 382-382 : CMRNFSRSDHLTTHIRTHTG Stoichiometry: 1.0 physical association physical association F6 EMBO-Journal homomint mint egr2-f2rl3-1 3 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:02:11 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Arg409Trp range MINT-2737754: original sequence: 409-409 : YCGRKFARSDERKRHTKIHL binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2737759: original sequence: 184-470 : DPSAFLSPPSTTSTSSLAYQPPPSYPSPKPAMDPGLIPMIPDYPGFFPSPCQRDPHGAAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPGAGVTGPGASGGGEGPRLPGSGSAAVTATPYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSAPPSAQSSASGPGGSQAGGSLCGNSAIGGPLASCTSRTRT Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F6 EMBO-Journal homomint mint egr2-pias2-2 1 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain proline rich range MINT-2737602: original sequence: 101-286 : IHSLPSTSITPHSPSSPVGSVLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEI Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1B F2B EMBO-Journal As shown in Figure 1B, GST-Krox20, but not GST alone, specifically retained PIASxb. These data establish that Krox20 and PIASxb can interact in vitro and that the interaction is direct. homomint mint egr2-pias2-3 2 6 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization F1C EMBO-Journal When both expression vectors were cotransfected, the nuclear distribution of Krox20 was modified towards a punctuated pattern, largely overlapping with that of PIASxb (Figure 1C). These data suggest that Krox20 and PIASxb colocalize when they are coexpressed, owing to sequestering of Krox20 by PIASxb in nuclear bodies. homomint mint egr2-pias2-4 4 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1D EMBO-Journal We also performed immunoprecipitation analyses on cotransfected COS7 cells, which revealed the presence of PIASxb among the proteins precipitated with an antibody directed against Krox20 (Figure 1D). homomint mint