MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The molecular chaperone Hsp90 delivers precursor proteins to the chloroplast import receptor Toc64. The molecular chaperone Hsp90 delivers precursor proteins to the chloroplast import receptor Toc64. EMBO J. (0261-4189) 2006 imex curation Qbadou S., Becker T., Mirus O., Tews I., Soll J., Schleiff E. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Qbadou S., Becker T., Mirus O., Tews I., Soll J., Schleiff E. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation The molecular chaperone Hsp90 delivers precursor proteins to the chloroplast import receptor Toc64. The molecular chaperone Hsp90 delivers precursor proteins to the chloroplast import receptor Toc64. EMBO J. (0261-4189) 2006 imex curation Qbadou S., Becker T., Mirus O., Tews I., Soll J., Schleiff E. 2009-01-08 Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Qbadou S., Becker T., Mirus O., Tews I., Soll J., Schleiff E. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation 1433_pea 14-3-3-like protein protein protein pea Pisum sativum (Garden pea) Garden pea MAAAHTPREENVYMAKLAEQAERYEEMVEFMEKVSANADSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVAVIRDYRSKIESELSNICDGILKLLDTRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTGYKSAQDIANAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKADEQQ mint 9A5D103E0F87C13A 14310_arath 14-3-3-like protein GF14 epsilon GRF10 General regulatory factor 10 T16E15.8 At1g22300 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MENEREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEESKGNDENVKRLKNYRKRVEDELAKVCNDILSVIDKHLIPSSNAVESTVFFYKMKGDYYRYLAEFSSGAERKEAADQSLEAYKAAVAAAENGLAPTHPVRLGLALNFSVFYYEILNSPESACQLAKQAFDDAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLNEEGDERTKGADEPQDEN 037405C341845C25 fer1_pea Ferredoxin-1, chloroplastic PETF FED1 Ferredoxin I protein protein pea Pisum sativum (Garden pea) Garden pea MATTPALYGTAVSTSFLRTQPMPMSVTTTKAFSNGFLGLKTSLKRGDLAVAMASYKVKLVTPDGTQEFECPSDVYILDHAEEVGIDLPYSCRAGSCSSCAGKVVGGEVDQSDGSFLDDEQIEAGFVLTCVAYPTSDVVIETHKEEDLTA 517ECE23CA85DC48 hsp7m_pea Heat shock 70 kDa protein, mitochondrial HSP1 protein protein pea Pisum sativum (Garden pea) Garden pea MAATLLRSLQRRNLSSSSVSAFRSLTGSTKTSYATHKLASLTRPFSSRPAGNDVIGIDLGTTNSCVSVMEGKNPKVIENSEGARTTPSVVAFNQKSELLVGTPAKRQAVTNPTNTLFGTKRLIGRRFDDAQTQKEMKMVPYKIVRAPNGDAWVEANGQQYSPSQIGAFVLTKIKETAEAYLGKTISKAVVTVPAYFNDAQRQATKDAGRIAGLDVQRIINEPTAAALSYGMNNKEGLIAVFDLGGGTFDVSILEISNGVFEVKATNGDTFLGGEDFDNALLDFLVSEFKRTESIDLAKDKLALQRLREAAEKAKIELSSTSQTEINLPFISADASGAKHLNITLTRSKFEALVNNLIERTKAPCKSCLKDANISIKDVDEVLLVGGMTRVPKVQQVVSEIFGKSPSKGVNPDEAVAMGAALQGGILRGDVKELLLLDVTPLSLGIETLGGIFTRLISRNTTIPTKKSQVFSTAADNQTQVGIKVLQGEREMAADNKSLGEFDLVGIPPAPRGLPQIEVTFDIDANGIVTVSAKDKSTGKEQQITIRSSGGLSDDEIDKMVKEAELHAQRDQERKALIDIRNSADTSIYSIEKSLAEYREKIPAEVAKEIEDAVSDLRTAMAGENADDIKAKLDAANKAVSKIGQHMSGGSSGGPSEGGSQGGEQAPEAEYEEVKK 56DCDFF6F4C97E5B psbo_pea Oxygen-evolving enhancer protein 1, chloroplastic PSBO 33 kDa subunit of oxygen evolving system of photosystem II OEC 33 kDa subunit 33 kDa thylakoid membrane protein protein protein pea Pisum sativum (Garden pea) Garden pea MAASLQAAATLMQPTKLRSNTLQLKSNQSVSKAFGLEHYGAKVTCSLQSDFKELAHKCVEASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFSFKPGKYNAKKLCLEPTSFTVKSEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSADGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKGKITLSVTQTKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLES mint Stabilizes the manganese cluster which is the primary site of water splitting 8F5F787616C5D8E6 psbo1_arath Oxygen-evolving enhancer protein 1-1, chloroplastic 33 kDa subunit of oxygen evolving system of photosystem II OEC 33 kDa subunit 33 kDa thylakoid membrane protein Manganese-stabilizing protein 1 PSBO1 PSBO At5g66570 K1F13.25 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE 73174DDC09C11E5C rbs1_pea Ribulose bisphosphate carboxylase small subunit, chloroplastic 1 RBCS1 PSSU1 protein protein pea Pisum sativum (Garden pea) Garden pea NTDITSNGERVKCMQVWPPIGKKKFETLSYLPPLTRDQLLKEVEYLLRKGWVPCLEFELLKGFVYGEHNKSPRYYDGRYWTMWKLPMFGTTDPAQVVKEVDEVVAAYPEAFVRVIGFNNVRQVQCISFIAHTPESY fragmentation type: fragment mint RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site 87DD3BAAB37DC6F6 hs704_arath Heat shock 70 kDa protein 4 HSP70-4 HSC70-4 HSP70 Heat shock cognate 70 kDa protein 4 Heat shock cognate protein 70-4 Heat shock protein 70-4 MED37C MED37_2 T16H11.7 T2E22.11 At3g12580 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPTNTVFDAKRLIGRRYSDPSVQADKSHWPFKVVSGPGEKPMIVVNHKGEEKQFSAEEISSMVLIKMREIAEAFLGSPVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKELESLCNPIIARMYQGAGPDMGGAGGMDDDTPAGGSGGAGPKIEEVD 33381E896461C5B9 q8gru8_arath At5g56010 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLKEDQMEYIEERRLKDLVKKHSEFISYPISLWIEKTIEKEISDDEEEEEKKDEEGKVEEVDEEKEKEDYNKFYEAFSKNLKLGIHEDSQNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIFYITGESKKGIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLKLDETEDEKKKKEELKEKFEGLCKVIKDVLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGGYMSSKKTMEINPENSIMDELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDEPNTFGSRIHRMLKLGLSIDDDDVVEADADMPPLEDDADAEGSKMEEVD mint B888E60AEA5F5977 plas_pea Plastocyanin, chloroplastic PETE protein protein pea Pisum sativum (Garden pea) Garden pea MATVTSTTVAIPSFSGLKTNAATKVSAMAKIPTSTSQSPRLCVRASLKDFGVALVATAASAVLASNALAVEVLLGASDGGLAFVPSSLEVSAGETIVFKNNAGFPHNVVFDEDEIPAGVDASKISMPEEDLLNAPGETYSVKLDAKGTYKFYCSPHQGAGMVGQVTVN mint Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I E2B2F6B7094FDF43 mdhp_pea Malate dehydrogenase [NADP], chloroplastic NADP-MDH protein protein pea Pisum sativum (Garden pea) Garden pea MALTQLNSTCSKPQLHSSSQLSFLSRTRTRTLPRHYHSTFAPLHRTQHARISCSVAPNQVQVPAAQTQDPKGKPDCYGVFCLTYDLKAEEETKSWKKLINIAVSGAAGMISNHLLFKLASGEVFGPDQPIALKLLGSERSIQALEGVAMELEDSLFPLLREVVISIDPYEVFQDAEWALLIGAKPRGPGVERAALLDINGQIFAEQGKALNAVASRNAKVIVVGNPCNTNALICLKNAPNIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARIDGLPVKEVIKDNKWLEEEFTEKVQKRGGVLIQKWGRSSAASTSVSIVDAIRSLITPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKGDGDYELVNDVIFDDYLRQKLAKTEAELLAEKKCVAHLTGEGIAVCDLPGDTMLPGEM mint The chloroplastic, NADP-dependent form is essential for the photosynthesis C4 cycle, which allows plants to circumvent the problem of photorespiration. In C4 plants, NADP-MDH activity acts to convert oxaloacetate to malate in chloroplasts of mesophyll cells for transport to the bundle sheath cells 613747E6357C325B toc64_pea Translocon at the outer membrane of chloroplasts 64 TOC64 protein protein pea Pisum sativum (Garden pea) Garden pea MKSMASPSSQIWVILGLGLAGIYVLTRKLTQAVKEDFGAFLLKLKLLPPPPPAPPKAPHPLSSLNFAISDIFDIEGHVSTFGHPEWARTHEPASSTASAVSALVESGATCIGTTVVDELAYGISGENKHFGTPTNPAVPNRVPGGSSSGAAVAVAANFVDFSLGVDTSGGVRVPAGFCGILGFRPSHGAVSHVGIIPVSTSLDTVGWFAKDPDVLRRVGHILLQAPFVMQRNPRQIIIADDCFQHLNVPLDRTSQVVIKATEKLFGKQVLKHINFEDYISSKVSSLKACSIQKSNGVLKSSSLKLLANVMQSLQRHEFEHTHSEWMSIVKPDLHPAVSAQLHEKFEVSELEIENSKSVRSELRVAVNSLLKDEGVLVIPTVADPPPKLGGKEFLSHDYQSRALSLLSIASISGCCQVTVPLGFFDKNPVSVSLIARHGGDRFLLDTLKTMYTVLQEQADIAAPSKSSKSVVSKEQSAEISKEKGNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLELGSYLQAEEDCTTAISFDKKNVKAYFRRGTAREMLGYYKEAIDDFKYALVLEPTNKRAASSAERLRKLFQ 084E16C7E54E663B rbs1a_arath Ribulose bisphosphate carboxylase small subunit 1A, chloroplastic RBCS-1A ATS1A F5A8.1 F1O19.14 At1g67090 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSMLSSATMVASPAQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELAKEVDYLIRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKPPSFTG 5DE768676D61F8F7 q9lkr1_pea protein protein pea Pisum sativum (Garden pea) Garden pea MDSQTLSSSSQFHEPNNLLNGVNGHGSDSDSDDGFVSGEDEAEPSTPILVYDAKSTVQVKEKEEESFDQESPRPIAKVTADDEDEAEEEEDDSQGVGLEKEGGGGGGKDVEEVKEDEVFVEANDKGFESVDSEGGDVVGEEINNGLREEGDGGTEIETVRSDSVVVEPVSVDNSGVGVVENGDGVVDNEKLTSGGDFVVDSLRVNPLVDGGVAVVGDEVKDEVSEIDGAVAPAPVASLDNSFEAIEKVGSRSVVDEVGSSFETIEKGDEVVVDDEVVGGDVEPSKVVDSGVEIEVDDNVAHEQLSDVVLTEKAGDVVVDENVGVGAKPDEVVDIGVDEGVAQRQVSDIAPAEKGEEISEVVSQSLEAAEDEINIENRVVEGGIESRVVEGGIESRVDDAVEGEVGSNVVEVEDGSNVDNVAEKDAVSNVDDAAEKDAVSNVDRVVEVEDESHVGNTVEGEARSNADHVLQVEDETHLDNAAVGEAKSNADRVVEVEDETPLDNAAVGEAESNVDPAVKVEDDTRFDNGAEGEAESNVDRVGEVEDDTHFDNAVEEEAESNVDRVVEVEDDTHFDNAVEEEADSNVDRVIEMDDGSHVEAAVDHHIDREIDDLLSDSKDESMIFGGSDSANKYLEELEKQIRDSESSQGDRIDGQIVTDSDEEDVSDEEGGSKELFDTATLAALLKAASGAGGEDGGGITLTAQDGSRLFSVERPAGLGPSLQTGKPAVRSIRPNLFAPSMSRAGTVVSDTDLSEEDKKKLEKLQEIRIKYLRVIQRLGFTTEESIAAQVLYRLTLVAGRQIGEMFSLDAAKESASRLEAEGRDDFAFSLNILVLGKTGVGKSATINSIFGETKTSFSAYGPATTSVTEIVGMVDGVEIRVFDTPGLKSSAFEQSYNRKVLSTVKKLTKKSPPDIVLYVDRLDLQTRDMNDLPMLRSVTSALGPTIWRNVIVTLTHAASAPPDGPSGSPLSYDVFVAQRSHIVQQAIGQAVGDLRLMNPNLMNPVSLVENHPSCRKNRDGQKVLPNGQSWKPLLLLLCYSMKILSEATNISKTQEAADNRRLFGFRSRAPPLPYLLSWLLQSRAHPKLPDQAGIDNGDSDIEMADLSDSDGEEGEDEYDQLPPFKPLKKSQIAKLNGEQRKAYLEEYDYRVKLLQKKQWREELKRMRDMKKRGKNGENDYMEEDEENGSPAAVPVPLPDMVLPQSFDSDNPAYRYRFLEPNSQLLTRPVLDTHSWDHDCGYDGVNIENSMAIINKFPAAVTVQVTKDKQDFSIHLDSSVAAKHGENGSTMAGFDIQNIGKQLAYIVRGETKFKNFKRNKTAAGVSVTFLGENVSTGVKLEDQIALGKRLVLVGSTGTVRSQNDSAYGANVEVRLREADFPVGQDQSSLSLSLVQWRGDLALGANFQSQISLGRSYKMAVRAGLNNKLSGQINVRTSSSDQLQIALIAILPVAKAIYKNFWPGVTENYSIY AA18A7C3DB5746C4 toc34_pea Translocase of chloroplast 34 34 kDa chloroplast outer envelope protein GTP-binding protein OEP34 GTP-binding protein IAP34 TOC34 IAP34 OEP34 protein protein pea Pisum sativum (Garden pea) Garden pea MASQQQTVREWSGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKDAQASDIPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQTITEVALNKSESIFVDKNLIDGPNPNQRGKLWIPLIFALQYLFLAKPIEALIRRDIATETKPAWETRDVGDRK DIP protein Q41009 original sequence version: 60 DIP protein Q41009 original sequence version: 90 00D5E79735BF041F toc75_pea Protein TOC75, chloroplastic 75 kDa translocon at the outer-envelope membrane of chloroplasts Import intermediate-associated protein of 75 kDa 75 kDa chloroplast outer envelope protein TOC75 IAP75 OEP75 protein protein pea Pisum sativum (Garden pea) Garden pea MRTSVIPNRLTPTLTTHPSRRRNDHITTRTSSLKCHLSPSSGDNNDSFNSSLLKTISTTVAVSSAAASAFFLTGSLHSPFPNFSGLNAAAGGGAGGGGGGSSSSGGGGGGWFNGDEGSFWSRILSPARAIADEPKSEDWDSHELPADITVLLGRLSGFKKYKISDILFFDRNKKSKVETQDSFLDMVSLKPGGVYTKAQLQKELESLATCGMFEKVDMEGKTNADGSLGLTISFAESMWERADRFRCINVGLMGQSKPVEMDPDMSEKEKIEFFRRQEREYKRRISSARPCLLPTSVHEEIKDMLAEQGRVSARLLQKIRDRVQSWYHEEGYACAQVVNFGNLNTREVVCEVVEGDITKLSIQYLDKLGNVVEGNTEGPVVQRELPKQLLPGHTFNIEAGKQALRNINSLALFSNIEVNPRPDEMNEGSIIVEIKLKELEQKSAEVSTEWSIVPGRGGRPTLASLQPGGTITFEHRNLQGLNRSLTGSVTTSNFLNPQDDLAFKMEYAHPYLDGVDNPRNRTLRVSCFNSRKLSPVFTGGPGVDEVPSIWVDRAGVKANITENFSRQSKFTYGLVMEEIITRDESNHICSNGQRVLPNGAISADGPPTTLSGTGIDRMAFLQANITRDNTRFVNGTIVGSRNMFQVDQGLGVGSNFPFFNRHQLTVTKFLQLMSVEEGAGKSPPPVLVLHGHYGGCVGDLPSYDAFTLGGPYSVRGYNMGEIGAARNILELAAEIRIPIKGTHVYAFAEHGTDLGSSKDVKGNPTVVYRRMGQGSSYGAGMKLGLVRAEYAVDHNSGTGAVFFRFGERF AFE51AE75F0617C5 toc34-grf10 2 17 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction F4D EMBO-Journal The interaction between 14-3-3 and import components were further confirmed by incubation of purified Toc34 and 14-3-3 in solution and subsequent co-immunoprecipitation by a14-3-3 or aToc34 antibodies mint grf10-toc34 2 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 17 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F4D EMBO-Journal The interaction between 14-3-3 and import components were further confirmed by incubation of purified Toc34 and 14-3-3 in solution and subsequent co-immunoprecipitation by a14-3-3 or aToc34 antibodies mint at5g56010-psbo1 2 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction F4H EMBO-Journal wgt-pSSU, wgt-pOE33 or rlt-pOE33 (pOE33-r, Figure 4H) were immunoprecipitated using antibodies against 14-3-3 (lane 5), Hsp70 (lane 3) or Hsp90 (lane 4). All proteins were precipitated by Hsp70 antibodies, but only pSSU by 14-3-3 antibodies. mint 1433-rbs1 2 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction F4H EMBO-Journal wgt-pSSU, wgt-pOE33 or rlt-pOE33 (pOE33-r, Figure 4H) were immunoprecipitated using antibodies against 14-3-3 (lane 5), Hsp70 (lane 3) or Hsp90 (lane 4). All proteins were precipitated by Hsp70 antibodies, but only pSSU by 14-3-3 antibodies. mint med37c-psbo1 2 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction F4H EMBO-Journal wgt-pSSU, wgt-pOE33 or rlt-pOE33 (pOE33-r, Figure 4H) were immunoprecipitated using antibodies against 14-3-3 (lane 5), Hsp70 (lane 3) or Hsp90 (lane 4). All proteins were precipitated by Hsp70 antibodies, but only pSSU by 14-3-3 antibodies. mint med37c-psbo-1 2 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction F4H EMBO-Journal wgt-pSSU, wgt-pOE33 or rlt-pOE33 (pOE33-r, Figure 4H) were immunoprecipitated using antibodies against 14-3-3 (lane 5), Hsp70 (lane 3) or Hsp90 (lane 4). All proteins were precipitated by Hsp70 antibodies, but only pSSU by 14-3-3 antibodies. mint med37c-rbs1 2 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction F4H EMBO-Journal wgt-pSSU, wgt-pOE33 or rlt-pOE33 (pOE33-r, Figure 4H) were immunoprecipitated using antibodies against 14-3-3 (lane 5), Hsp70 (lane 3) or Hsp90 (lane 4). All proteins were precipitated by Hsp70 antibodies, but only pSSU by 14-3-3 antibodies. mint toc34-toc64-1 2 14 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2584707: original sequence: 477-593 : AEISKEKGNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLELGSYLQAEEDCTTAISFDKKNVKAYFRRGTAREMLGYYKEAIDDFKYALVLEPTNKRAASSAERLRKLF Stoichiometry: 1.0 17 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction F9B F9D EMBO-Journal mint toc64-toc34 2 14 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 17 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction F9C EMBO-Journal Using purified proteins, an interaction of Toc64 with Toc34GMP-PNP, but not with Toc159GMP-PNP (Figure 9C, lane 2) could be established mint toc64-toc34-1 2 17 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 14 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction F9A EMBO-Journal association of Toc64 with either Toc159 or Toc34. mint toc64-q9lkr1 2 14 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 16 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction F9A EMBO-Journal association of Toc64 with either Toc159 or Toc34. mint toc64-toc75 2 18 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 14 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction F9A EMBO-Journal mint at5g56010-toc64 1 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 14 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2584479: original sequence: 477-593 : AEISKEKGNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLELGSYLQAEEDCTTAISFDKKNVKAYFRRGTAREMLGYYKEAIDDFKYALVLEPTNKRAASSAERLRKLF Stoichiometry: 1.0 direct interaction direct interaction F5A EMBO-Journal mint toc64-med37c 1 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate Stoichiometry: 1.0 14 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2584503: original sequence: 477-593 : AEISKEKGNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLELGSYLQAEEDCTTAISFDKKNVKAYFRRGTAREMLGYYKEAIDDFKYALVLEPTNKRAASSAERLRKLF undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:47:13 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Asp516Ala range MINT-2584527: original sequence: 516-516 : LCGNNATYYSNRAQAYLELG Q9MUK5:p.Arg550Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:09:17 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 14:25:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg550ala' Tue Jun 30 19:38:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg550Ala' range MINT-2584524: original sequence: 550-550 : FDKKNVKAYFRRGTAREMLG Stoichiometry: 1.0 physical association physical association F5C F6C EMBO-Journal Replacing arginine 550 facing the chaperone binding pocket within Toc64TPR by alanine (Figure 6B, 5th helix, red) reduces the interaction of Toc64TPR with Hsp90 or Hsp70 from wheat germ lysate mint at5g56010-toc34 1 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 17 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction EMBO-Journal F9E mint toc64-psbo1 1 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 14 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2584039: original sequence: 477-593 : AEISKEKGNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLELGSYLQAEEDCTTAISFDKKNVKAYFRRGTAREMLGYYKEAIDDFKYALVLEPTNKRAASSAERLRKLF his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1D F2D EMBO-Journal pOE33 was recognised by Toc64TPR mint toc34-psbo1 1 17 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association F1D EMBO-Journal mint toc64-rbcs_1a 1 14 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 15 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association F1D F2D EMBO-Journal we observed a strong association of pSSU with a Toc64DTPR affinity matrix mint toc34-rbcs_1a 1 17 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 15 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association F1D EMBO-Journal mint toc64-mdhp 1 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 14 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F2D EMBO-Journal mint toc64-petf 1 14 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association F2D EMBO-Journal the association of the nucleotide transport protein 1 (pNTT1), the precursor of the malate dehydrogenase (pMDH), ferredoxin (pFd) or plastocyanine 1 (pPC) with the different Toc64 polypeptides was analysed (Figure 2D and F). Like for pOE33, an association of wgt-pNTT1, pPC with the TPR was observed. mint toc64-pete 1 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 14 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2584219: original sequence: 477-593 : AEISKEKGNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLELGSYLQAEEDCTTAISFDKKNVKAYFRRGTAREMLGYYKEAIDDFKYALVLEPTNKRAASSAERLRKLF his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F2D EMBO-Journal the association of the nucleotide transport protein 1 (pNTT1), the precursor of the malate dehydrogenase (pMDH), ferredoxin (pFd) or plastocyanine 1 (pPC) with the different Toc64 polypeptides was analysed (Figure 2D and F). Like for pOE33, an association of wgt-pNTT1, pPC with the TPR was observed. mint toc34-3 1 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate Stoichiometry: 1.0 17 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4C F4B EMBO-Journal We obtained an interaction of the major guidance complex component 14-3-3 with Toc34, Interaction occurs also using wheat germ extract. mint toc64-hsp1 1 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate Stoichiometry: 1.0 14 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2584673: original sequence: 477-593 : AEISKEKGNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLELGSYLQAEEDCTTAISFDKKNVKAYFRRGTAREMLGYYKEAIDDFKYALVLEPTNKRAASSAERLRKLF his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5G EMBO-Journal Toc64 recognises both, Hsp70 and Hsp90 present in wheat germ lysate as determined by their interaction with a matrix charged with Toc64 or Toc64TPR mint