IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CRIg: a macrophage complement receptor required for phagocytosis of circulating pathogens. CRIg: a macrophage complement receptor required for phagocytosis of circulating pathogens. Cell (0092-8674) 2006 imex curation Helmy KY., Katschke KJ., Gorgani NN., Kljavin NM., Elliott JM., Diehl L., Scales SJ., Ghilardi N., van Lookeren Campagne M. menno@gene.com 304..306 304..316 2006-07-04: Only interaction involving solely Proteins were exported. Only protein-protein interactions 7 in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs predetermined predetermined participant predetermined Helmy KY., Katschke KJ., Gorgani NN., Kljavin NM., Elliott JM., Diehl L., Scales SJ., Ghilardi N., van Lookeren Campagne M. Soluble form of human CRIg was generated in which the extracellular domain of CRIg was fused to the Fc portion of human IgG1, fusion protein bound was reconstituted with increasing concentrations of purified human C3. 2B menno@gene.com Accepted 2006-MAR-17 by ORCHARD. Cell (0092-8674) 2006 304..306 304..316 2006-07-04: Only interaction involving solely Proteins were exported. Only protein-protein interactions 7 imex curation CRIg: a macrophage complement receptor required for phagocytosis of circulating pathogens. CRIg: a macrophage complement receptor required for phagocytosis of circulating pathogens. Cell (0092-8674) 2006 imex curation Helmy KY., Katschke KJ., Gorgani NN., Kljavin NM., Elliott JM., Diehl L., Scales SJ., Ghilardi N., van Lookeren Campagne M. menno@gene.com 304..306 304..316 2006-07-04: Only interaction involving solely Proteins were exported. Only protein-protein interactions 7 in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs predetermined predetermined participant predetermined Helmy KY., Katschke KJ., Gorgani NN., Kljavin NM., Elliott JM., Diehl L., Scales SJ., Ghilardi N., van Lookeren Campagne M. Soluble form of human CRIg was generated in which the extracellular domain of CRIg was fused to the Fc portion of human IgG1, fusion protein bound was reconstituted with increasing concentrations of purified human C3. 2e and 3C menno@gene.com Accepted 2006-MAR-17 by ORCHARD. Cell (0092-8674) 2006 304..306 304..316 2006-07-04: Only interaction involving solely Proteins were exported. Only protein-protein interactions 7 imex curation CRIg: a macrophage complement receptor required for phagocytosis of circulating pathogens. CRIg: a macrophage complement receptor required for phagocytosis of circulating pathogens. Cell (0092-8674) 2006 imex curation Helmy KY., Katschke KJ., Gorgani NN., Kljavin NM., Elliott JM., Diehl L., Scales SJ., Ghilardi N., van Lookeren Campagne M. menno@gene.com 304..306 304..316 2006-07-04: Only interaction involving solely Proteins were exported. Only protein-protein interactions 7 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Helmy KY., Katschke KJ., Gorgani NN., Kljavin NM., Elliott JM., Diehl L., Scales SJ., Ghilardi N., van Lookeren Campagne M. Soluble form of human CRIg was generated in which the extracellular domain of CRIg was fused to the Fc portion of human IgG1, fusion protein bound was reconstituted with increasing concentrations of purified human C3. 2D menno@gene.com Accepted 2006-MAR-16 by ORCHARD. Cell (0092-8674) 2006 304..306 304..316 2006-07-04: Only interaction involving solely Proteins were exported. Only protein-protein interactions 7 imex curation CRIg: a macrophage complement receptor required for phagocytosis of circulating pathogens. CRIg: a macrophage complement receptor required for phagocytosis of circulating pathogens. Cell (0092-8674) 2006 imex curation Helmy KY., Katschke KJ., Gorgani NN., Kljavin NM., Elliott JM., Diehl L., Scales SJ., Ghilardi N., van Lookeren Campagne M. menno@gene.com 304..306 304..316 2006-07-04: Only interaction involving solely Proteins were exported. Only protein-protein interactions 7 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Helmy KY., Katschke KJ., Gorgani NN., Kljavin NM., Elliott JM., Diehl L., Scales SJ., Ghilardi N., van Lookeren Campagne M. Soluble form of human CRIg was generated in which the extracellular domain of CRIg was fused to the Fc portion of human IgG1, fusion protein bound was reconstituted with increasing concentrations of purified human C3. 2C menno@gene.com Accepted 2006-MAR-17 by ORCHARD. Cell (0092-8674) 2006 304..306 304..316 2006-07-04: Only interaction involving solely Proteins were exported. Only protein-protein interactions 7 imex curation q9y279-1 V-set and immunoglobulin domain-containing protein 4 VSIG4 CRIg Z39IG Protein Z39Ig UNQ317/PRO362 protein protein human Homo sapiens Human MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVFAIILIISLCCMVVFTMAYIMLCRKTSQQEHVYEAARAHAREANDSGETMRVAIFASGCSSDEPTSQNLGNNYSDEPCIGQEYQIIAQINGNYARLLDTVPLDYEFLATEGKSVC 735CA3BC58185035 o95973_human IGM protein protein human Homo sapiens Human MKHLWFFLLLVAAPRWVLSQLQLQESGPGLVKPSETLSLSCTVSGGSISSTNYYWGWIRQPPEKGLEWIGSLHNSGSDYYNPSLKSRVTISVDTSKNQFSLRLSSVTAADTAVYYCARLGMGAFDFWGHGTMVTVSSGSASAPTLFPPSS 85664E04938AA7C9 q9y279-2 V-set and immunoglobulin domain-containing protein 4 Z39IG Protein Z39Ig UNQ317/PRO362 VSIG4 CRIg protein protein human Homo sapiens Human MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVFAIILIISLCCMVVFTMAYIMLCRKTSQQEHVYEAAR No experimental confirmation available. B2AB2E3151D39C6E co3_human Complement C3 C3 CPAMD1 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1 protein protein human Homo sapiens Human MGPTSGPSLLLLLLTHLPLALGSPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEVVLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKTPKYFKPGMPFDLMVFVTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPLSITVRTKKQELSEAEQATRTMQALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYYTYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCVGSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDKGVFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAELQCPQPAARRRRSVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLARSNLDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN DIP protein P01024 original sequence version: 140 DIP protein P01024 original sequence version: 148 30C2832A9E75FFC4 z39ig-c3 1 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component extracellular region binding region binding-associated region binding region range range range range fc region of huigg1 CRIg was fused to the Fc portion of human IgG1 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component physical association physical association The hu CRIg(L) was expressed on the surface of Human Jurkat cells and the was purified from human serum. Complement C3 was the protein involved in the interaction. z39ig-c3-1 3 5 unspecified role unspecified role bait bait extracellular region binding region binding-associated region binding region range range range range fc region of huigg1 CRIg was fused to the Fc portion of human IgG1 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey physical association physical association Q9Y279-1; P01024 purified Complement protein C3 was involved in the interaction. z39ig-c3-2 3 7 unspecified role unspecified role bait bait extracellular region binding region binding-associated region binding region range range range range fc region tagged tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey physical association physical association q9y279-2; P01024 purified Complement C3 protein was involved in the interaction. z39ig-c3b 4 5 unspecified role unspecified role bait bait fc region of huigg1 CRIg was fused to the Fc portion of human IgG1 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined extracellular region binding region binding-associated region binding region range range range range 8 unspecified role unspecified role prey prey P01024:p.Arg1320Glu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain R E Wed May 02 15:20:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1320glu' Tue Jun 30 17:09:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1320Glu' physical association physical association P01024; Q9Y279-1 purified Complement C3b was the interacting C3 protein. z39ig-c3b-1 4 7 unspecified role unspecified role bait bait extracellular region binding region binding-associated region binding region range range range range fc region tagged tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey P01024:p.Arg1320Glu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain R E Wed May 02 16:30:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1320glu' Tue Jun 30 19:55:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1320Glu' physical association physical association Q9Y279-2; P01024 purified Complement C3b was the interacting protein. z39ig-c3b-2 2 5 unspecified role unspecified role bait bait extracellular region binding region binding-associated region binding region range range range range 8 unspecified role unspecified role prey prey region alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The CRIg molecule was on the surface of the THP-1 cells C3b was the complement protein which took part in the interaction. This interaction was competed out by unlabelled C3b dimer molecules. z39ig-c3b-3 2 5 unspecified role unspecified role bait bait extracellular region binding region binding-associated region binding region range range range range 8 unspecified role unspecified role prey prey region alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P01024:p.Arg1320Glu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain R E Wed May 02 17:46:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1320glu' Tue Jun 30 18:03:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1320Glu' physical association physical association The CRIg molecule was on the surface of the Kuffer cells from wild type mice. This interaction was not observed in knockout mice for CRIg. c3b was the protein that took part in the interaction. This interaction was competed out by unlabelled C3b dimer molecules.