IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A dynamically localized protease complex and a polar specificity factor control a cell cycle master regulator. A dynamically localized protease complex and a polar specificity factor control a cell cycle master regulator. Cell (0092-8674) 2006 imex curation McGrath PT., Iniesta AA., Ryan KR., Shapiro L., McAdams HH. cell lysates taken from LS4326 (CtrA-M2) or LS4328 (ClpX-M2) strains 7A, 7B shapiro@stanford.edu Only protein-protein interactions 4 caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot McGrath PT., Iniesta AA., Ryan KR., Shapiro L., McAdams HH. cell lysates taken from LS4326 (CtrA-M2) or LS4328 (ClpX-M2) strains 7A, 7B shapiro@stanford.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. Cell (0092-8674) 2006 Only protein-protein interactions 4 imex curation ctra_cauvc Cell cycle transcriptional regulator CtrA Response regulator SokA ctrA sokA CC_3035 protein protein caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides MRVLLIEDDSATAQTIELMLKSEGFNVYTTDLGEEGVDLGKIYDYDLILLDLNLPDMSGIDVLRTLRVAKINTPIMILSGSSEIDTKVKTFAGGADDYMTKPFHKDEMIARIHAVVRRSKGHAQSVIKTGDIVVNLDAKTVEVNGNRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLAASAHGKHHIETVWGRGYVLRDPNEQVNAA DIP protein P0CAW8 original sequence version: 33 BB812AF6EDAADBF8 q9a3a9_cauvc rcdA CC_3295 protein protein caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides MTEVNAFADTPWRAGVIQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRLTTRLMQVASWLLVQRAVREGEMPPEAACAEAYRLAEEAPADGPAVEELPFGLMNLLQRSERLYERVRHLDRRMYVESPNEEAPRPVQNQLDRLTAAFGG B4081DB6AC65C7D6 clpx_cauvc ATP-dependent Clp protease ATP-binding subunit ClpX clpX CC_1961 protein protein caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides MTKAASGDTKSTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREEHKIAFVKSKDGVPTPREICEVLDDYVIGQGHAKKVLAVAVHNHYKRLNHASKNNDVELAKSNILLVGPTGTGKTLLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIVLKLLQAADYNVERAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLEKIISARGAAKSIGFGAKVTDPEERRTGEILRNVEPDDLQRFGLIPEFIGRLPVVATLEDLDEAALVKILTEPKNAFVKQYQRLFEMENIGLTFTEDALHQVAKKAIARKTGARGLRSIMEGILLETMFELPTYEGVEEVVVNAEVVEGRAQPLLIYAEKKGGAASA DIP protein P0CAU2 original sequence version: 43 036339E2AB315C11 ctra-rcda 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait m2 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association clpx-rcda-1 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait m2 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association clpx-ctra 1 4 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait m2 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association clpx-rcda 1 3 unspecified role unspecified role bait bait m2 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association