MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Huckebein-mediated autoregulation of Glide/Gcm triggers glia specification. Huckebein-mediated autoregulation of Glide/Gcm triggers glia specification. EMBO J. (0261-4189) 2006 imex curation De Iaco R., Soustelle L., Kammerer M., Sorrentino S., Jacques C., Giangrande A. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence De Iaco R., Soustelle L., Kammerer M., Sorrentino S., Jacques C., Giangrande A. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Huckebein-mediated autoregulation of Glide/Gcm triggers glia specification. Huckebein-mediated autoregulation of Glide/Gcm triggers glia specification. EMBO J. (0261-4189) 2006 imex curation De Iaco R., Soustelle L., Kammerer M., Sorrentino S., Jacques C., Giangrande A. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence De Iaco R., Soustelle L., Kammerer M., Sorrentino S., Jacques C., Giangrande A. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation gcm_drome Transcription factor glial cells missing gcm CG12245 Protein glide protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVLNGMPITMPVPMPVPMPVPSPPATKSRVAIDWDINDSKMPSVGEFDDFNDWSNGHCRLIYSVQSDEARKHASGWAMRNTNNHNVNILKKSCLGVLLCSAKCKLPNGASVHLRPAICDKARRKQQGKQCPNRNCNGRLEIQACRGHCGYPVTHFWRRDGNGIYFQAKGTHDHPRPEAKGSTEARRLLAGGRRVRSLAVMLARESALSDKLSSLRPTKRQAKTQSIQESKRRRMGASDVLETKQELVVPPTTYLPTSTPTHSTNFNQSQGSYVPAGQGSVISQWNREIHYETEDPCYANGMYSYDMLHSPLSAHSSTGSYYQENKPQQLQHSQYQQQLSPQQHVPVSYDPSQPISSSLQCGMPSYEICDDTSSLTSSSGYCSEDYGYYNGYLPNSLDVSNGSQSQNLSQDASFYTTSSEIFSVFESTLNGGGTSGVDLIYDEATAYQQHQQQGTFPHLTNYQQEPQDQMQSADYYYSNTGVDNSWNIQMDATYHPVNSTDPIYC DIP protein Q27403 original sequence version: 77 0ED74C2D3B9BBCB0 q9vn10_drome hkb CG9768 5953 Dmel\CG9768 HKB Hkb anon-82B3 gurt Dmel_CG9768 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTINLHPPQTYSRLFRPWDTQRQAATSAAPRTVKQEPEAITIKTELASSSFGHDCDGDFSSASSSASSSSNSSKSCYEEALNHSSYTRTSTPLLDAAPHPVFSHPQSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAAAAAAASTPTAVPGFGMDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHMPQERQLGPSIFVPMYSYLYGY 6CE4030C11B7A896 hkb-gcm 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-2740484: original sequence: 160-297 : MDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHMPQERQLGPSIFVPMYSYLYG gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain range MINT-2736537: original sequence: 1-421 : MVLNGMPITMPVPMPVPMPVPSPPATKSRVAIDWDINDSKMPSVGEFDDFNDWSNGHCRLIYSVQSDEARKHASGWAMRNTNNHNVNILKKSCLGVLLCSAKCKLPNGASVHLRPAICDKARRKQQGKQCPNRNCNGRLEIQACRGHCGYPVTHFWRRDGNGIYFQAKGTHDHPRPEAKGSTEARRLLAGGRRVRSLAVMLARESALSDKLSSLRPTKRQAKTQSIQESKRRRMGASDVLETKQELVVPPTTYLPTSTPTHSTNFNQSQGSYVPAGQGSVISQWNREIHYETEDPCYANGMYSYDMLHSPLSAHSSTGSYYQENKPQQLQHSQYQQQLSPQQHVPVSYDPSQPISSSLQCGMPSYEICDDTSSLTSSSGYCSEDYGYYNGYLPNSLDVSNGSQSQNLSQDASFYTTSSEI Stoichiometry: 1.0 physical association physical association F4C F4E EMBO-Journal We performed GST pull-down assays by using an Hkb GST fusion expressed in bacteria and found that in vitro-translated Gcm binds GST Hkb, but not GST alone (negative control) (Figure 4C). Binding specificity was further confirmed by using in vitro-translated Luciferase instead of Gcm (Figure 4C). Deletion analyses indicate that binding is mediated by Gcm Nt and HKB C-terminal (Ct-Hkb) regions (Figures 4C and E). mint gcm-hkb 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain range MINT-2736563: original sequence: 1-263 : MVLNGMPITMPVPMPVPMPVPSPPATKSRVAIDWDINDSKMPSVGEFDDFNDWSNGHCRLIYSVQSDEARKHASGWAMRNTNNHNVNILKKSCLGVLLCSAKCKLPNGASVHLRPAICDKARRKQQGKQCPNRNCNGRLEIQACRGHCGYPVTHFWRRDGNGIYFQAKGTHDHPRPEAKGSTEARRLLAGGRRVRSLAVMLARESALSDKLSSLRPTKRQAKTQSIQESKRRRMGASDVLETKQELVVPPTTYLPTSTPTHS tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association SF1 EMBO-Journal Gcm Hkb interactions were also confirmed in two-hybrid assay (Supplementary Figure 1). mint