MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The Nfs1 interacting protein Isd11 has an essential role in Fe/S cluster biogenesis in mitochondria. The Nfs1 interacting protein Isd11 has an essential role in Fe/S cluster biogenesis in mitochondria. EMBO J. (0261-4189) 2006 imex curation Adam AC., Bornhövd C., Prokisch H., Neupert W., Hell K. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Adam AC., Bornhövd C., Prokisch H., Neupert W., Hell K. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation The Nfs1 interacting protein Isd11 has an essential role in Fe/S cluster biogenesis in mitochondria. The Nfs1 interacting protein Isd11 has an essential role in Fe/S cluster biogenesis in mitochondria. EMBO J. (0261-4189) 2006 imex curation Adam AC., Bornhövd C., Prokisch H., Neupert W., Hell K. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Adam AC., Bornhövd C., Prokisch H., Neupert W., Hell K. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation The Nfs1 interacting protein Isd11 has an essential role in Fe/S cluster biogenesis in mitochondria. The Nfs1 interacting protein Isd11 has an essential role in Fe/S cluster biogenesis in mitochondria. EMBO J. (0261-4189) 2006 imex curation Adam AC., Bornhövd C., Prokisch H., Neupert W., Hell K. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Adam AC., Bornhövd C., Prokisch H., Neupert W., Hell K. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation nfs1_yeast Cysteine desulfurase, mitochondrial NFS1 SPL1 YCL017C tRNA-splicing protein SPL1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLKSTATRSITRLSQVYNVPAATYRACLVSRRFYSPPAAGVKLDDNFSLETHTDIQAAAKAQASARASASGTTPDAVVASGSTAMSHAYQENTGFGTRPIYLDMQATTPTDPRVLDTMLKFYTGLYGNPHSNTHSYGWETNTAVENARAHVAKMINADPKEIIFTSGATESNNMVLKGVPRFYKKTKKHIITTRTEHKCVLEAARAMMKEGFEVTFLNVDDQGLIDLKELEDAIRPDTCLVSVMAVNNEIGVIQPIKEIGAICRKNKIYFHTDAAQAYGKIHIDVNEMNIDLLSISSHKIYGPKGIGAIYVRRRPRVRLEPLLSGGGQERGLRSGTLAPPLVAGFGEAARLMKKEFDNDQAHIKRLSDKLVKGLLSAEHTTLNGSPDHRYPGCVNVSFAYVEGESLLMALRDIALSSGSACTSASLEPSYVLHALGKDDALAHSSIRFGIGRFSTEEEVDYVVKAVSDRVKFLRELSPLWEMVQEGIDLNSIKWSGH D709E326B3921BCC D709E326B3921BCC isd11_yeast Protein ISD11 Iron-sulfur protein biogenesis, desulfurase-interacting protein 11 YER048W-A ISD11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH 5FC241A528BCCB2A isd11-nfs1-4 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F4B EMBO-Journal (Figure 4B). Together with HA-tagged Isd11, Nfs1 was co-precipitated from the cell extract and was not detectable in the supernatant fraction of the precipitation. homomint mint isd11-nfs1-5 3 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F4C EMBO-Journal When mitochondrial extracts of WT cells were subjected to co-immunoprecipitation with antibodies against Isd11 and Nfs1, Isd11 was co-precipitated with Nfs1 and vice versa (Figure 4C). homomint mint nfs1-isd11-2 3 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F4C EMBO-Journal When mitochondrial extracts of WT cells were subjected to co-immunoprecipitation with antibodies against Isd11 and Nfs1, Isd11 was co-precipitated with Nfs1 and vice versa (Figure 4C). homomint mint isd11-nfs1-6 2 4 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4A EMBO-Journal Significant amounts of two proteins with a molecular weight of about 45 and 14 kDa were coeluted in a specific manner from the beads incubated with the extract containing his-tagged Isd11 (Figure 4A). These proteins were absent in the eluate from the WT strain, in contrast to a few additional other proteins. Mass spectroscopy identified the 45 kDa protein as the mitochondrial desulfurase of the ISC machinery, Nfs1, and the 14 kDa protein as Isd11. homomint mint