IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ In vivo imaging of MADS-box transcription factor interactions. In vivo imaging of MADS-box transcription factor interactions. J. Exp. Bot. (0022-0957) 2006 imex curation Tonaco IA., Borst JW., de Vries SC., Angenent GC., Immink RG. Directed yeast two hybrid Richard.Immink@wur.nl Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast protein three hybrid protein three hybrid trihybrid bridge assay protein 3-hybrid protein tri hybrid trihybrid bridge assay predetermined predetermined participant predetermined Tonaco IA., Borst JW., de Vries SC., Angenent GC., Immink RG. Directed yeast two hybrid Richard.Immink@wur.nl Accepted 2006-OCT-4 by ORCHARD. J. Exp. Bot. (0022-0957) 2006 Only protein-protein interactions imex curation In vivo imaging of MADS-box transcription factor interactions. In vivo imaging of MADS-box transcription factor interactions. J. Exp. Bot. (0022-0957) 2006 imex curation Tonaco IA., Borst JW., de Vries SC., Angenent GC., Immink RG. Directed yeast two hybrid Richard.Immink@wur.nl Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tonaco IA., Borst JW., de Vries SC., Angenent GC., Immink RG. Directed yeast two hybrid Richard.Immink@wur.nl Accepted 2006-OCT-4 by ORCHARD. J. Exp. Bot. (0022-0957) 2006 Only protein-protein interactions imex curation In vivo imaging of MADS-box transcription factor interactions. In vivo imaging of MADS-box transcription factor interactions. J. Exp. Bot. (0022-0957) 2006 imex curation Tonaco IA., Borst JW., de Vries SC., Angenent GC., Immink RG. Directed yeast two hybrid Richard.Immink@wur.nl Only protein-protein interactions viguu Vigna unguiculata subsp. unguiculata (Cowpea) Vigna sinensis fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Tonaco IA., Borst JW., de Vries SC., Angenent GC., Immink RG. Directed yeast two hybrid Richard.Immink@wur.nl Accepted 2006-OCT-4 by ORCHARD. J. Exp. Bot. (0022-0957) 2006 Only protein-protein interactions imex curation In vivo imaging of MADS-box transcription factor interactions. In vivo imaging of MADS-box transcription factor interactions. J. Exp. Bot. (0022-0957) 2006 imex curation Tonaco IA., Borst JW., de Vries SC., Angenent GC., Immink RG. Directed yeast two hybrid Richard.Immink@wur.nl Only protein-protein interactions viguu Vigna unguiculata subsp. unguiculata (Cowpea) Vigna sinensis fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Tonaco IA., Borst JW., de Vries SC., Angenent GC., Immink RG. Directed yeast two hybrid Richard.Immink@wur.nl Accepted 2006-OCT-4 by ORCHARD. J. Exp. Bot. (0022-0957) 2006 Only protein-protein interactions imex curation q40882_pethy fbp11 protein protein pethy Petunia hybrida (Petunia) MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRVYEYANNNIKGTIERYKKATAETSNACTTQELNAQFYQQESKKLRQQIQLLQNTNRHLVGEGLSALNVRELKQLENRLERGITRIRSKKHEMILAETENLQKREIQLEQENTFLRSKIAENERLQELSMMPATGQEYNAFQQYFARNMLQLNMMEGGVPSYDPLPAHDKKSLQLE 1658ABF23C1FC7AE q9atf3_pethy FBP4 protein protein pethy Petunia hybrida (Petunia) MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMSTTLEKYHRYCYGALEGSQPSTDSQNIYQEYLKLKTRVEALQQSQRHMLGADLGQLGTKDLEQLERQLDSSLRQIRSTRTQNMLDQLSELQEKQEQSLIEMNKSLRMKLEELGVAFQTSMHSGEESVQYRQQPAEPEGLFHPVECNNSLPIRYNTLPREHVVPSAQDSTGVLPGWML EB0EE356439BD41F agl9_pethy Agamous-like MADS-box protein AGL9 homolog Floral homeotic protein FBP2 Floral-binding protein 2 FBP2 protein protein pethy Petunia hybrida (Petunia) MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTLKQRLMEGSTLNLQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIGYQNDPITVGGAGPSVNNYMAGWLP B575BE9468D310BB q43616_pethy fbp7 protein protein pethy Petunia hybrida (Petunia) MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSTRGRVYEYSNNNIRAIIDRYKKATVETSNAFTTQELNAQFYQQESKKLRQQIQLIQNSNRHLVGEGLSSLNVRELKQLENRLERGIARIRSKKHEMILAESEDLQKREIQLEQENAFLRSKIAENERLQELSMMPAGGQEYNAIQQYLARNMLQLNMMEGVPSYPLPSDKKSLDLE 56AE8DAEE198CC84 fbp24_pethy MADS-box protein FBP24 FBP24 Floral-binding protein 24 protein protein pethy Petunia hybrida (Petunia) MIIMGRGKIEVKRIENKTSRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSKGKLFEYCSQPHSMSQIISRYLQTTGASLPVEDNRVQLYDEVAKMRRDTLNLQLSLQRYKGDDLSLAQYEELNELEKQLEHALNKIRARKLELMQQQMENLKKTEKMLEKENHDMYQWLMNNQMYKQESAAMDHEDHHHHHEHQQAITELNLLGEQPLLSHFTFFGDQEQPSTSTVNHFASISLTSPPANSISPYRLQPSHPNLQDSHVHGPSYD 4C854DB87F36F16A fbp24-fbp2 2 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association fbp24-fbp4 2 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association fbp24-fbp11 1 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role ancillary ancillary 9 unspecified role unspecified role bait bait physical association physical association Table 1. The interaction was described as weak and could be deteced at room temperature and low concentrations of 3AT (1mM). The authors describe the FBP2 protein as having its Cterminal domain deleted but do not give the precise coordinates of the region deleted. fbp24-fbp7 1 7 unspecified role unspecified role ancillary ancillary 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Table 1. The interaction was described as weak and could be deteced at room temperature and low concentrations of 3AT (1mM). The authors describe the FBP2 protein as having its Cterminal domain deleted but do not give the precise coordinates of the region deleted. fbp24-fbp2-1 4 7 unspecified role unspecified role neutral component neutral component c terminal yellow fluorescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role neutral component neutral component c terminal cyan florescent protein cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 1 F The proteins colocalised to the nucleus fbp24-fbp11-1 4 9 unspecified role unspecified role neutral component neutral component c terminal yellow florescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component c terminal cyan florescent protein cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 1 J fbp24-fbp2-2 3 7 unspecified role unspecified role neutral component neutral component c terminal cyan fluorescent protein cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role neutral component neutral component c terminal yellow florescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 2 M - O The proteins colocalised to the nucleus fbp24-fbp11-2 3 9 unspecified role unspecified role neutral component neutral component c terminal yellow florescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component c terminal cyan florescent protein cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 2 P - R A distrbution of different fluorescence lfetime values over the nucleus was observed, suggesting sub-nuclear regions with and without interaction between the proteins. fbp24-fbp24 3 9 unspecified role unspecified role neutral component neutral component c terminal yellow florescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role neutral component neutral component c terminal cyan florescent protein cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 2 S - U A distrbution of different fluorescence lfetime values over the nucleus was observed, suggesting sub-nuclear regions with and without interaction between the proteins. fbp2-fbp11-2 3 5 unspecified role unspecified role neutral component neutral component c terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component c terminal cyan florescent protein cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figure 2 J - L The proteins localised to the nucleus.