IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis. The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis. Mol. Cell (1097-2765) 2004 imex curation Teige M., Scheikl E., Eulgem T., Doczi R., Ichimura K., Shinozaki K., Dangl JL., Hirt H. markus.teige@univie.ac.at 13-SEP-2006: Contacted by JYOTI Only protein-protein interactions in vitro In vitro in gel kinase assay in-gel kinase assay in gel kinase assay predetermined predetermined participant predetermined Teige M., Scheikl E., Eulgem T., Doczi R., Ichimura K., Shinozaki K., Dangl JL., Hirt H. markus.teige@univie.ac.at Accepted 2006-AUG-29 by JYOTI. 13-SEP-2006: Contacted by JYOTI Mol. Cell (1097-2765) 2004 Only protein-protein interactions imex curation The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis. The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis. Mol. Cell (1097-2765) 2004 imex curation Teige M., Scheikl E., Eulgem T., Doczi R., Ichimura K., Shinozaki K., Dangl JL., Hirt H. markus.teige@univie.ac.at 13-SEP-2006: Contacted by JYOTI Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Teige M., Scheikl E., Eulgem T., Doczi R., Ichimura K., Shinozaki K., Dangl JL., Hirt H. markus.teige@univie.ac.at Accepted 2006-AUG-29 by JYOTI. 13-SEP-2006: Contacted by JYOTI Mol. Cell (1097-2765) 2004 Only protein-protein interactions imex curation mpk4_arath Mitogen-activated protein kinase 4 MPK4 At4g01370 F2N1.1 F2N1_2-t protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAESCFGSSGDQSSSKGVATHGGSYVQYNVYGNLFEVSRKYVPPLRPIGRGAYGIVCAATNSETGEEVAIKKIGNAFDNIIDAKRTLREIKLLKHMDHENVIAVKDIIKPPQRENFNDVYIVYELMDTDLHQIIRSNQPLTDDHCRFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKLGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGETMTREPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSAGAVDLLEKMLVFDPSRRITVDEALCHPYLAPLHDINEEPVCVRPFNFDFEQPTLTEENIKELIYRETVKFNPQDSV 448F65C25C95AAEB mpk6_arath Mitogen-activated protein kinase 6 MPK6 At2g43790 F18O19.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDGGSGQPAADTEMTEAPGGFPAAAPSPQMPGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENIVAIRDIIPPPLRNAFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPLAIDLIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFENHALSEEQMKELIYREALAFNPEYQQ 296D2BD753C6DDA4 m2k1_arath Mitogen-activated protein kinase kinase 1 NMAPKK AtMEK1 MKK1 MEK1 At4g26070 F20B18.180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNRGSLCPNPICLPPLEQSISKFLTQSGTFKDGDLRVNKDGIQTVSLSEPGAPPPIEPLDNQLSLADLEVIKVIGKGSSGNVQLVKHKLTQQFFALKVIQLNTEESTCRAISQELRINLSSQCPYLVSCYQSFYHNGLVSIILEFMDGGSLADLLKKVGKVPENMLSAICKRVLRGLCYIHHERRIIHRDLKPSNLLINHRGEVKITDFGVSKILTSTSSLANSFVGTYPYMSPERISGSLYSNKSDIWSLGLVLLECATGKFPYTPPEHKKGWSSVYELVDAIVENPPPCAPSNLFSPEFCSFISQCVQKDPRDRKSAKELLEHKFVKMFEDSDTNLSAYFTDAGSLIPPLAN D889CFBB97653B8E m2k2_arath Mitogen-activated protein kinase kinase 2 MKK2 MAP2K MK1 At4g29810 F27B13.50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKKGGFSNNLKLAIPVAGEQSITKFLTQSGTFKDGDLRVNKDGVRIISQLEPEVLSPIKPADDQLSLSDLDMVKVIGKGSSGVVQLVQHKWTGQFFALKVIQLNIDEAIRKAIAQELKINQSSQCPNLVTSYQSFYDNGAISLILEYMDGGSLADFLKSVKAIPDSYLSAIFRQVLQGLIYLHHDRHIIHRDLKPSNLLINHRGEVKITDFGVSTVMTNTAGLANTFVGTYNYMSPERIVGNKYGNKSDIWSLGLVVLECATGKFPYAPPNQEETWTSVFELMEAIVDQPPPALPSGNFSPELSSFISTCLQKDPNSRSSAKELMEHPFLNKYDYSGINLASYFTDAGSPLATLGNLSGTFSV 3E7EFC6D3A831D93 mpk5_arath Mitogen-activated protein kinase 5 MPK5 At4g11330 F8L21.120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKEIESATDLGDTNIKGVLVHGGRYFQYNVYGNLFEVSNKYVPPIRPIGRGAYGFVCAAVDSETHEEIAIKKIGKAFDNKVDAKRTLREIKLLRHLEHENVVVIKDIIRPPKKEDFVDVYIVFELMDTDLHQIIRSNQSLNDDHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNSNCDLKITDFGLARTTSETEYMTEYVVTRWYRAPELLLNSSEYTSAIDVWSVGCIFAEIMTREPLFPGKDYVHQLKLITELIGSPDGASLEFLRSANARKYVKELPKFPRQNFSARFPSMNSTAIDLLEKMLVFDPVKRITVEEALCYPYLSALHDLNDEPVCSNHFSFHFEDPSSTEEEIKELVWLESVKFNPLPSI 2E8C0E5FC47685DF mkk2-mpk4 2 6 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Figure 1A and 1B mkk2-mpk6 2 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Figure 1A and 1B mkk2-mpk5 2 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Figure 1A and 1B Interaction of MKK2 and MPK5 was judged to be 'weak' from results of beta-galastosidase assay (Figure 1B). mkk1-mpk4 2 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Figure 1A and 1B mkk2-mpk6-1 1 6 enzyme enzyme unspecified role unspecified role 4 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation Figure 1C mkk2-mpk4-1 1 3 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 enzyme enzyme unspecified role unspecified role phosphorylation phosphorylation reaction phosphorylation Figure 1C mkk1-mpk4-1 1 5 enzyme enzyme unspecified role unspecified role 3 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation Figure 1C