UniProt UniProt http://www.uniprot.org The vertebrate Ndc80 complex contains Spc24 and Spc25 homologs, which are required to establish and maintain kinetochore-microtubule attachment. The vertebrate Ndc80 complex contains Spc24 and Spc25 homologs, which are required to establish and maintain kinetochore-microtubule attachment. Curr. Biol. (0960-9822) 2004 McCleland ML., Kallio MJ., Barrett-Wilt GA., Kestner CA., Shabanowitz J., Hunt DF., Gorbsky GJ., Stukenberg PT. pts7h@virginia.edu xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western McCleland ML., Kallio MJ., Barrett-Wilt GA., Kestner CA., Shabanowitz J., Hunt DF., Gorbsky GJ., Stukenberg PT. pts7h@virginia.edu Accepted 2006-OCT-9 by JYOTI. Curr. Biol. (0960-9822) 2004 The vertebrate Ndc80 complex contains Spc24 and Spc25 homologs, which are required to establish and maintain kinetochore-microtubule attachment. The vertebrate Ndc80 complex contains Spc24 and Spc25 homologs, which are required to establish and maintain kinetochore-microtubule attachment. Curr. Biol. (0960-9822) 2004 McCleland ML., Kallio MJ., Barrett-Wilt GA., Kestner CA., Shabanowitz J., Hunt DF., Gorbsky GJ., Stukenberg PT. pts7h@virginia.edu human-dld1 Human colorectal adenocarcinoma dld1 Human colon adenocarcinoma fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining McCleland ML., Kallio MJ., Barrett-Wilt GA., Kestner CA., Shabanowitz J., Hunt DF., Gorbsky GJ., Stukenberg PT. pts7h@virginia.edu Accepted 2006-OCT-9 by JYOTI. Curr. Biol. (0960-9822) 2004 The vertebrate Ndc80 complex contains Spc24 and Spc25 homologs, which are required to establish and maintain kinetochore-microtubule attachment. The vertebrate Ndc80 complex contains Spc24 and Spc25 homologs, which are required to establish and maintain kinetochore-microtubule attachment. Curr. Biol. (0960-9822) 2004 McCleland ML., Kallio MJ., Barrett-Wilt GA., Kestner CA., Shabanowitz J., Hunt DF., Gorbsky GJ., Stukenberg PT. pts7h@virginia.edu xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant McCleland ML., Kallio MJ., Barrett-Wilt GA., Kestner CA., Shabanowitz J., Hunt DF., Gorbsky GJ., Stukenberg PT. pts7h@virginia.edu Accepted 2006-OCT-9 by JYOTI. Curr. Biol. (0960-9822) 2004 spc25_human Kinetochore protein Spc25 AD024 SPC25 SPBC25 protein protein human Homo sapiens Human MVEDELALFDKSINEFWNKFKSTDTSCQMAGLRDTYKDSIKAFAEKLSVKLKEEERMVEMFLEYQNQISRQNKLIQEKKDNLLKLIAEVKGKKQELEVLTANIQDLKEEYSRKKETISTANKANAERLKRLQKSADLYKDRLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVYN DIP protein Q9HBM1 original sequence version: 126 DIP protein Q9HBM1 original sequence version: 110 6DED3216794F4512 spc24_xenla Kinetochore protein Spc24 spbc24 spc24 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MLCEQISEYVDVSREIVKVMVSDSAAGALKKSLDRQEAMIDSLLDTEVQASQLIRDLMAVEEKVAQKLLDTEETKQKSSSKLQKIDRELQERMEKNASLESSIKFLQKDLEELKVMEEEIADMQREADEDTTTVIPSAVYLAKLFHNVTKIDWDYNCDPSLIKGIHYGGDIAQPISIDSNQHSKIFICNYLWSLLSTDW 0E49B6BD9F03D46A spc25_xenla Kinetochore protein Spc25 spc25 spbc25 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSALKMDDEQSLNVYMQEFRTRFINKSSDEMTSQALKESYKESAATDAWFKKYRDGELMIEKVLEFRNEITLQNKRIEEKQKNILQEAAKQDDHEQLKGELTERIQRLREELNQKREVALANRKANKERIKELQKSATLFKERLGLEIRKLRGDKLQFVFRCINPKDLDQPYSCIISLNAEGDYEVAGCDPPLECIAEFQEKIRETRNFSALLANLRKSFTALGSQVK 8B4916508876C344 nuf2a_xenla Kinetochore protein Nuf2-A Cell division cycle-associated protein 1-A nuf2-a cdca1-a protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDKLTFPIFPAADLVNFFRQNILTGTEAKNFNKNDIFPNPKPEMVQKLYMRILQQVFNYGVEQFYMVPMDLDIQYPHLVEGFAPVANILKLMARFLPMCRVYDFHPSDVLNPKGKRTLHSLSGIVNFLHFSATRKEVYFEYCSSYKSALENVRQLQKANQEAEIKIEKLTTVPPEQQAEFKALSSEIHDLQQIISQEYRAKDVAFQEKIAQRKTEFAEKNKRLNEQKLAIATMKEEQERMKSQIVESPEQRKSKTERMKETVHRLKQARQETNDKCDYYRDRVAFACMWQTDVQGYLKKLQGIDTNLEIHRKIREEIRHSEEQVVNLNLELKSLSNEDAQLKRIILVKKEKLAKVDIKNKKKQEDFNQQKQEILEVCSRIQEKRQVVHGRVAQVLQEIQQTIGKKEQLLETTEAGKKKCQEVITDFRAALEKYHDSLQKASERSADRRREKIAELNRRLSRR 4C2E5299D9ED6CB0 spc24_human Kinetochore protein Spc24 SPBC24 SPC24 protein protein human Homo sapiens Human MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLYLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW DIP protein Q8NBT2 original sequence version: 102 C5D99CE1F1A8F355 ndc80_xenla Kinetochore protein NDC80 homolog kntc2 Kinetochore protein Hec1 Kinetochore-associated protein 2 ndc80 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MRRSSVTNRQSLLPLRVQDANRMGLTTPQNKDRQGFGKLSMSKPHSGTSEKKTSFFGKRASNGTARTSQYGAFGGTEKIKDPRPLHDKAFIQQCIRQLCEFLNENGYSQALTVKSLQGPSTKDFLKIFAFIYTFICPNYENPESKFEEEIPRIFKELGYPFALSKSSMYTVGAPHTWPQIVAALVWLIDCVKLCCVLRSENPVFEDPPMGEQSENGIDFNQLFLDYTVRCYDQFMEGRDTFEEYDTDVCIRLKEAYHVDESNLEALQQESRRLMEEIERLEKEKENEPDRLASMRKLKASLQADIQKYQNYLTEIESHSTLLDQRVSSISEELEATELESRAIQQENLRLKNILDNQKYSVADIERIKYEETELQQTIAKLTKDLDEDKQQLWHEELKYAKMKESVETQLSEFHKIGRKVRLIPPTAEFANGYDFQIQCNLDSEQSSLMHYRNKINVPLVEILSQSEGHIASSTNKKMGVEDMVEQLNTLIGEKKNEVKVQKDEAQKLEEIYQQKVEESEEHEKRWISEIESLEKHRQLLESGVNKSLDEAMKDLQKEQQELQLVEHRTEEEMRQVENKLVRVVHAVANHVAVIEKHLEEKRLKVEREYEEFMKEDLLLDLRELLEKYKEKARVLDSL 6D725844D425F29E kntc2-cdca1-5 3 6 unspecified role unspecified role unspecified role unspecified role 5 unspecified role unspecified role unspecified role unspecified role 7 unspecified role unspecified role unspecified role unspecified role 9 unspecified role unspecified role unspecified role unspecified role association association Fig. 1A spbc24-spbc25-5 2 8 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 1C kntc2-cdca1-6 1 9 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association Fig. 1D cdca1-kntc2-1 1 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association Fig. 1D spbc24-kntc2-1 1 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait association association Fig. 1D spbc25-kntc2-1 1 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association Fig. 1D