UniProt UniProt http://www.uniprot.org Identification of two novel components of the human NDC80 kinetochore complex. Identification of two novel components of the human NDC80 kinetochore complex. J. Biol. Chem. (0021-9258) 2004 imex curation Bharadwaj R., Qi W., Yu H. hongtao.yu@utsouthwestern.edu 30-OCT-2006: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Bharadwaj R., Qi W., Yu H. hongtao.yu@utsouthwestern.edu Accepted 2006-SEP-19 by DAVET. 30-OCT-2006: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Identification of two novel components of the human NDC80 kinetochore complex. Identification of two novel components of the human NDC80 kinetochore complex. J. Biol. Chem. (0021-9258) 2004 imex curation Bharadwaj R., Qi W., Yu H. hongtao.yu@utsouthwestern.edu 30-OCT-2006: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Bharadwaj R., Qi W., Yu H. hongtao.yu@utsouthwestern.edu Accepted 2006-OCT-3 by DAVET. 30-OCT-2006: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Identification of two novel components of the human NDC80 kinetochore complex. Identification of two novel components of the human NDC80 kinetochore complex. J. Biol. Chem. (0021-9258) 2004 imex curation Bharadwaj R., Qi W., Yu H. hongtao.yu@utsouthwestern.edu 30-OCT-2006: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bharadwaj R., Qi W., Yu H. hongtao.yu@utsouthwestern.edu Accepted 2006-SEP-19 by DAVET. 30-OCT-2006: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Identification of two novel components of the human NDC80 kinetochore complex. Identification of two novel components of the human NDC80 kinetochore complex. J. Biol. Chem. (0021-9258) 2004 imex curation Bharadwaj R., Qi W., Yu H. hongtao.yu@utsouthwestern.edu 30-OCT-2006: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Bharadwaj R., Qi W., Yu H. hongtao.yu@utsouthwestern.edu Accepted 2006-SEP-19 by DAVET. 30-OCT-2006: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation spc25_human Kinetochore protein Spc25 AD024 SPC25 SPBC25 protein protein human Homo sapiens Human MVEDELALFDKSINEFWNKFKSTDTSCQMAGLRDTYKDSIKAFAEKLSVKLKEEERMVEMFLEYQNQISRQNKLIQEKKDNLLKLIAEVKGKKQELEVLTANIQDLKEEYSRKKETISTANKANAERLKRLQKSADLYKDRLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVYN DIP protein Q9HBM1 original sequence version: 126 DIP protein Q9HBM1 original sequence version: 110 6DED3216794F4512 nuf2_human Kinetochore protein Nuf2 NUF2 CDCA1 NUF2R Cell division cycle-associated protein 1 protein protein human Homo sapiens Human METLSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYMEFLWQYKSSADKMQQLNAAHQEALMKLERLDSVPVEEQEEFKQLSDGIQELQQSLNQDFHQKTIVLQEGNSQKKSNISEKTKRLNELKLSVVSLKEIQESLKTKIVDSPEKLKNYKEKMKDTVQKLKNARQEVVEKYEIYGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKEKLATAQFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTTINQEIQKIKLGIQQLKDAAEREKLKSQEIFLNLKTALEKYHDGIEKAAEDSYAKIDEKTAELKRKMFKMST DIP protein Q9BZD4 original sequence version: 113 DIP protein Q9BZD4 original sequence version: 119 250BFED5AD87153B ndc80_human Kinetochore protein NDC80 homolog Kinetochore protein Hec1 Kinetochore-associated protein 2 Highly expressed in cancer protein Retinoblastoma-associated protein HEC NDC80 HEC KNTC2 HEC1 protein protein human Homo sapiens Human MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKRTSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKESSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENTRLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLNAMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE DIP protein O14777 original sequence version: 126 DIP protein O14777 original sequence version: 132 6A82DA4D8B77ECDC spc24_human Kinetochore protein Spc24 SPBC24 SPC24 protein protein human Homo sapiens Human MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLYLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW DIP protein Q8NBT2 original sequence version: 102 C5D99CE1F1A8F355 kntc2-spbc24-3 1 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey association association Fig. 1B kntc2-spbc25-1 3 5 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Transfection Fig. 2A kntc2-spbc25-2 3 5 unspecified role unspecified role bait bait n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Transfection kntc2-spbc25-3 4 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2C kntc2-spbc25-4 2 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig. 2D