IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ BTBD1 and BTBD2 colocalize to cytoplasmic bodies with the RBCC/tripartite motif protein, TRIM5delta. BTBD1 and BTBD2 colocalize to cytoplasmic bodies with the RBCC/tripartite motif protein, TRIM5delta. Exp. Cell Res. (0014-4827) 2003 imex curation Xu L., Yang L., Moitra PK., Hashimoto K., Rallabhandi P., Kaul S., Meroni G., Jensen JP., Weissman AM., D'Arpa P. pdarpa@usuhs.mil Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Xu L., Yang L., Moitra PK., Hashimoto K., Rallabhandi P., Kaul S., Meroni G., Jensen JP., Weissman AM., D'Arpa P. pdarpa@usuhs.mil Accepted 2006-JUN-6 by DAVET. Exp. Cell Res. (0014-4827) 2003 Only protein-protein interactions imex curation BTBD1 and BTBD2 colocalize to cytoplasmic bodies with the RBCC/tripartite motif protein, TRIM5delta. BTBD1 and BTBD2 colocalize to cytoplasmic bodies with the RBCC/tripartite motif protein, TRIM5delta. Exp. Cell Res. (0014-4827) 2003 imex curation Xu L., Yang L., Moitra PK., Hashimoto K., Rallabhandi P., Kaul S., Meroni G., Jensen JP., Weissman AM., D'Arpa P. pdarpa@usuhs.mil Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Xu L., Yang L., Moitra PK., Hashimoto K., Rallabhandi P., Kaul S., Meroni G., Jensen JP., Weissman AM., D'Arpa P. pdarpa@usuhs.mil Accepted 2006-JUN-6 by DAVET. Exp. Cell Res. (0014-4827) 2003 Only protein-protein interactions imex curation btbd2_human BTB/POZ domain-containing protein 2 BTBD2 protein protein human Homo sapiens Human MAAGGSGGRASCPPGVGVGPGTGGSPGPSANAAATPAPGNAAAAAAAAAAAAAAPGPTPPAPPGPGTDAQAAGAERAEEAAGPGAAALQREAAYNWQASKPTVQERFAFLFNNEVLCDVHFLVGKGLSSQRIPAHRFVLAVGSAVFDAMFNGGMATTSTEIELPDVEPAAFLALLKFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNLRADNAFMLLTQARLFDEPQLASLCLENIDKNTADAITAEGFTDIDLDTLVAVLERDTLGIREVRLFNAVVRWSEAECQRQQLQVTPENRRKVLGKALGLIRFPLMTIEEFAAGPAQSGILVDREVVSLFLHFTVNPKPRVEFIDRPRCCLRGKECSINRFQQVESRWGYSGTSDRIRFSVNKRIFVVGFGLYGSIHGPTDYQVNIQIIHTDSNTVLGQNDTGFSCDGSASTFRVMFKEPVEVLPNVNYTACATLKGPDSHYGTKGLRKVTHESPTTGAKTCFTFCYAAGNNNGTSVEDGQIPEVIFYT 5F4856161702A65D ub2d2_human Ubiquitin-conjugating enzyme E2 D2 UBC5B UBCH4 UBE2D2 UBC4 UBCH5B Ubiquitin-protein ligase D2 Ubiquitin carrier protein D2 Ubiquitin-conjugating enzyme E2-17 kDa 2 Ubiquitin-conjugating enzyme E2(17)KB 2 PUBC1 p53-regulated ubiquitin-conjugating enzyme 1 (E3-independent) E2 ubiquitin-conjugating enzyme D2 E2 ubiquitin-conjugating enzyme D2 protein protein human Homo sapiens Human MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM DIP protein P62837 original sequence version: 81 DIP protein P62837-1 original sequence version: 134 DIP protein P62837 original sequence version: 95 DIP protein P62837 original sequence version: 139 DIP protein P62837 original sequence version: 37 DIP protein P62837 original sequence version: 115 DIP protein P62837 original sequence version: 58 DIP protein P62837 original sequence version: 74 DIP protein P62837 original sequence version: 103 DIP protein P62837 original sequence version: 101 C942BE7853CBC355 btbd1_human BTB/POZ domain-containing protein 1 BTBD1 C15orf1 Hepatitis C virus NS5A-transactivated protein 8 NS5ATP8 protein protein human Homo sapiens Human MASLGPAAAGEQASGAEAEPGPAGPPPPPSPSSLGPLLPLQREPLYNWQATKASLKERFAFLFNSELLSDVRFVLGKGRGAAAAGGPQRIPAHRFVLAAGSAVFDAMFNGGMATTSAEIELPDVEPAAFLALLRFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCLDTIDKSTMDAISAEGFTDIDIDTLCAVLERDTLSIRESRLFGAVVRWAEAECQRQQLPVTFGNKQKVLGKALSLIRFPLMTIEEFAAGPAQSGILSDREVVNLFLHFTVNPKPRVEYIDRPRCCLRGKECCINRFQQVESRWGYSGTSDRIRFTVNRRISIVGFGLYGSIHGPTDYQVNIQIIEYEKKQTLGQNDTGFSCDGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT 525A49E01728AFF0 q9c035-4 Tripartite motif-containing protein 5 TRIM5 RNF88 RING finger protein 88 RING-type E3 ubiquitin transferase TRIM5 protein protein human Homo sapiens Human MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLRELISDLEHRLQGSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWGWSAMARSRFTATSTSQIQAILLPQPPK AB54B894549C8775 btbd1-btbd2-1 2 3 unspecified role unspecified role neutral component neutral component n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role neutral component neutral component colocalization colocalization Q9H0C5 transfection; 3c Endogenous BTBD1 immunostaining ( Fig. 3A) and transfected GFP-BTBD2 ( Fig. 3B) colocalize in transfected cells btbd1-btbd2-2 2 5 unspecified role unspecified role neutral component neutral component n-terminus dsred-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role neutral component neutral component colocalization colocalization Q9BX70 transfection; 3i DsRed-BTBD1 ( Fig. 3G) and endogenous BTBD2 immunostaining ( Fig. 3H) colocalize btbd2-trim5-1 2 3 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9C035-4:p.[Cys15Ala;Cys18Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Fri Jul 22 11:11:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys18ala,cys15ala' Wed May 02 14:38:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys15ala,cys18ala' Tue Jun 30 19:15:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys15Ala;Cys18Ala]' coiled coil region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range colocalization colocalization Q9H0C5 transfection; 4c, 4f, 4i GFP-TRIM5delta; [2] co-localized with endogenous BTBD2 btbd1-btbd2-3 2 3 unspecified role unspecified role neutral component neutral component n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range btb region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role neutral component neutral component n-terminus ds-red tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Q9H0C5 transfection; Q9BX70 transfection; 5 Requirement of the RING domain and the coiled-coil region of TRIM5δ for colocalization with BTBD1/2 btbd2-btbd2-1 2 3 unspecified role unspecified role neutral component neutral component n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role neutral component neutral component n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range btb region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain colocalization colocalization Q9BX70 transfection; 5 BTBD2(149�525)-myc, was co-expressed with either DsRed-BTBD1, GFP-BTBD2, or GFP-TRIM5delta;, instead of localizing to nuclear speckles, it localized together with DsRed-BTBD1, GFP-BTBD2, or GFP-TRIM5delta; to cytoplasmic bodies. Other fragments having an intact BTB/POZ domain localized diffusely when expressed alone, but, when expressed with full-length DsRed-BTBD1 or myc-BTBD2, also co-localized to cytoplasmic bodies (Fig. 5, 1�217, 103�217, and 103� 525). btbd2-trim5-2 2 6 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain colocalization colocalization Q9BX70 transfection; Q9C035-4 transfection; 5 myc-BTBD2 (410�525), did co-localize to cytoplasmic bodies when coexpressed with GFP-TRIM5δ trim5-6 1 6 self self unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9C035-4:p.[Cys15Ala;Cys18Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Fri Jul 22 11:01:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys18ala,cys15ala' Wed May 02 18:41:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys15ala,cys18ala' Tue Jun 30 17:53:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys15Ala;Cys18Ala]' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role ancillary ancillary ubiquitination ubiquitination reaction ubiquitination Update to ancillary molecule when CV updated TRIM5delta exhibited E3 activity toward itself in vitro in a reaction that was RING dependent and required UbcH5B 6 Presence of UBE2D2 required for ubiquitinylation