IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ KaiB functions as an attenuator of KaiC phosphorylation in the cyanobacterial circadian clock system. KaiB functions as an attenuator of KaiC phosphorylation in the cyanobacterial circadian clock system. EMBO J. (0261-4189) 2003 imex curation Kitayama Y., Iwasaki H., Nishiwaki T., Kondo T. fig 3 kondo@bio.nagoya-u.ac.jp Only protein-protein interactions syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kitayama Y., Iwasaki H., Nishiwaki T., Kondo T. fig 3 kondo@bio.nagoya-u.ac.jp Accepted 2006-JUN-5 by ORCHARD. EMBO J. (0261-4189) 2003 Only protein-protein interactions imex curation KaiB functions as an attenuator of KaiC phosphorylation in the cyanobacterial circadian clock system. KaiB functions as an attenuator of KaiC phosphorylation in the cyanobacterial circadian clock system. EMBO J. (0261-4189) 2003 imex curation Kitayama Y., Iwasaki H., Nishiwaki T., Kondo T. fig 3 kondo@bio.nagoya-u.ac.jp Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Kitayama Y., Iwasaki H., Nishiwaki T., Kondo T. ATP gamma 32P is used for the kinase assay. fig 3 kondo@bio.nagoya-u.ac.jp Accepted 2006-JUN-5 by ORCHARD. EMBO J. (0261-4189) 2003 Only protein-protein interactions imex curation kaia_syne7 Circadian clock protein KaiA see0009 kaiA Synpcc7942_1218 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MLSQIAICIWVESTAILQDCQRALSADRYQLQVCESGEMLLEYAQTHRDQIDCLILVAANPSFRAVVQQLCFEGVVVPAIVVGDRDSEDPDEPAKEQLYHSAELHLGIHQLEQLPYQVDAALAEFLRLAPVETMADHIMLMGANHDPELSSQQRDLAQRLQERLGYLGVYYKRDPDRFLRNLPAYESQKLHQAMQTSYREIVLSYFSPNSNLNQSIDNFVNMAFFADVPVTKVVEIHMELMDEFAKKLRVEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPRET DIP protein Q79PF6 original sequence version: 52 DIP protein Q79PF6 original sequence version: 58 DIP protein Q79PF6 original sequence version: 81 7C4F3B79FFDF59A2 kaib_syne7 Circadian clock protein KaiB kaiB see0010 Synpcc7942_1217 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MSPRKTYILKLYVAGNTPNSVRALKTLKNILEVEFQGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPLPVRRIIGDLSDREKVLIGLDLLYGELQDSDDF DIP protein Q79PF5 original sequence version: 53 DIP protein Q79PF5 original sequence version: 78 4E7FD086742A398F kaic_syne7 Circadian clock protein kinase KaiC see0011 kaiC Synpcc7942_1216 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MTSAEMTSPNNNSEHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPDPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEEFVSDNVVILRNVLEGERRRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLGAMRLTQRSSNVRVSSGVVRLDEMCGGGFFKDSIILATGATGTGKTLLVSRFVENACANKERAILFAYEESRAQLLRNAYSWGMDFEEMERQNLLKIVCAYPESAGLEDHLQIIKSEINDFKPARIAIDSLSALARGVSNNAFRQFVIGVTGYAKQEEITGLFTNTSDQFMGAHSITDSHISTITDTIILLQYVEIRGEMSRAINVFKMRGSWHDKAIREFMISDKGPDIKDSFRNFERIISGSPTRITVDEKSELSRIVRGVQEKGPES DIP protein Q79PF4 original sequence version: 65 DIP protein Q79PF4 original sequence version: 71 DIP protein Q79PF4 original sequence version: 105 855DFE131EFFF3CF kaic-kaia 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey association association Interaction between kaiC and kaiB is induced after 20 hours of continous light. KaiC rhythmically associated with KaiA prior to binding with KaiB (16-20 hours continuous light). Phosphorylation of KaiC is observed after 6-18 hours of continous light. kaic-kaia-6 2 4 inhibitor inhibitor unspecified role unspecified role ecoli Escherichia coli (strain K12) 5 self self unspecified role unspecified role ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role ancillary ancillary ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation KaiB interacts with the KaiA�KaiC complex during the late subjective night. KaiB�KaiC binding is accompanied by a dramatic reduction in KaiC phosphorylation and is followed by dissociation of the complex. KaiB interacts with a KaiA�KaiC complex during the late subjective night. KaiB�KaiC binding is accompanied by a dramatic reduction in KaiC phosphorylation and followed by dissociation of the clock protein complex(es). kaic-kaic-17 2 5 putative self putative self putative self putative self ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation true kaic-kaia-7 2 3 unspecified role unspecified role ancillary ancillary ecoli Escherichia coli (strain K12) 5 self self unspecified role unspecified role ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Addition of KaiA activates the autophosphorylation activity of KaiC. KaiC rhythmically associated with KaiA prior to binding with KaiB