IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Cortactin interacts with WIP in regulating Arp2/3 activation and membrane protrusion. Cortactin interacts with WIP in regulating Arp2/3 activation and membrane protrusion. Curr. Biol. (0960-9822) 2003 imex curation Kinley AW., Weed SA., Weaver AM., Karginov AV., Bissonette E., Cooper JA., Parsons JT. fig 1 jtp@virginia.edu 9.5-day mouse embyo library. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kinley AW., Weed SA., Weaver AM., Karginov AV., Bissonette E., Cooper JA., Parsons JT. fig 1 jtp@virginia.edu Accepted 2006-APR-20 by DAVET. 9.5-day mouse embyo library. Curr. Biol. (0960-9822) 2003 Only protein-protein interactions imex curation Cortactin interacts with WIP in regulating Arp2/3 activation and membrane protrusion. Cortactin interacts with WIP in regulating Arp2/3 activation and membrane protrusion. Curr. Biol. (0960-9822) 2003 imex curation Kinley AW., Weed SA., Weaver AM., Karginov AV., Bissonette E., Cooper JA., Parsons JT. fig 1 jtp@virginia.edu 9.5-day mouse embyo library. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kinley AW., Weed SA., Weaver AM., Karginov AV., Bissonette E., Cooper JA., Parsons JT. Purified bait and prey proteins were mixed. fig 1 jtp@virginia.edu Accepted 2006-APR-20 by DAVET. 9.5-day mouse embyo library. Curr. Biol. (0960-9822) 2003 Only protein-protein interactions imex curation Cortactin interacts with WIP in regulating Arp2/3 activation and membrane protrusion. Cortactin interacts with WIP in regulating Arp2/3 activation and membrane protrusion. Curr. Biol. (0960-9822) 2003 imex curation Kinley AW., Weed SA., Weaver AM., Karginov AV., Bissonette E., Cooper JA., Parsons JT. fig 1 jtp@virginia.edu 9.5-day mouse embyo library. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kinley AW., Weed SA., Weaver AM., Karginov AV., Bissonette E., Cooper JA., Parsons JT. The bait was mixed with lysate of cells over-expressing the prey. fig 1 jtp@virginia.edu Accepted 2006-APR-20 by DAVET. 9.5-day mouse embyo library. Curr. Biol. (0960-9822) 2003 Only protein-protein interactions imex curation Cortactin interacts with WIP in regulating Arp2/3 activation and membrane protrusion. Cortactin interacts with WIP in regulating Arp2/3 activation and membrane protrusion. Curr. Biol. (0960-9822) 2003 imex curation Kinley AW., Weed SA., Weaver AM., Karginov AV., Bissonette E., Cooper JA., Parsons JT. fig 1 jtp@virginia.edu 9.5-day mouse embyo library. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kinley AW., Weed SA., Weaver AM., Karginov AV., Bissonette E., Cooper JA., Parsons JT. fig 1 jtp@virginia.edu Accepted 2006-APR-20 by DAVET. 9.5-day mouse embyo library. Curr. Biol. (0960-9822) 2003 Only protein-protein interactions imex curation Cortactin interacts with WIP in regulating Arp2/3 activation and membrane protrusion. Cortactin interacts with WIP in regulating Arp2/3 activation and membrane protrusion. Curr. Biol. (0960-9822) 2003 imex curation Kinley AW., Weed SA., Weaver AM., Karginov AV., Bissonette E., Cooper JA., Parsons JT. fig 1 jtp@virginia.edu 9.5-day mouse embyo library. Only protein-protein interactions rat-ref52 Rattus norvegicus embryonic fibroblast cells ref52 Rattus norvegicus embryonic fibroblast cell line fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Kinley AW., Weed SA., Weaver AM., Karginov AV., Bissonette E., Cooper JA., Parsons JT. fig 1 jtp@virginia.edu Accepted 2006-APR-20 by DAVET. 9.5-day mouse embyo library. Curr. Biol. (0960-9822) 2003 Only protein-protein interactions imex curation o70420_rat protein protein rat Rattus norvegicus (Rat) Rat MWKASAGHAVSITQDDGEADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKENELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVPIEAVTSKTSNIRANFESLAKEREQEDRRKAEAERAQRMAQERQEQEARRKLEEQARAKKQTPPASPSPQPAEDRPPSSPIYEDTAPLKAEPSYGSSEPEPEYSTEAAGLPEASNQQGLAYTSEPVYETTEVPGHYQAEDDTYDGYESDLGITAIALYDYQAAGDDEISFDPDDVITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ C0DA73F766739F11 nck1_human Cytoplasmic protein NCK1 NCK1 NCK NCK adaptor protein 1 SH2/SH3 adaptor protein NCK-alpha protein protein human Homo sapiens Human MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS 554E9B1A936AEF30 src8_mouse Src substrate cortactin Cttn Ems1 protein protein mouse Mus musculus Mouse MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDRSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSSAVGFDYKERLAKHESQQDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVPIEAVTSKTSNIRANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTPPASPSPQPIEDRPPSSPIYEDAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTSEPVYETTEAPGHYQAEDDTYDGYESDLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ DIP protein Q60598 original sequence version: 136 DIP protein Q60598 original sequence version: 78 DIP protein Q60598 original sequence version: 135 8F5CA026ACCD6D4F wipf1_mouse WAS/WASL-interacting protein family member 1 Wiskott-Aldrich syndrome protein-interacting protein Wipf1 Wip Waspip protein protein mouse Mus musculus Mouse MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILDKPKGAGASAGGYGGGGGGGGGGGGGGGGSGGNFGGGGPPGLGGLFQAGMPKLRSTANRDNDSGGSRPPILPPGGRATSAKPFSPPSGPGRFPAPSPGHRSGPPEPPRNRMPPPRPDVGSKPDSLPPPVPNTPRPVPSSLHNRGSPAGLGAPRPPFPGNRGAAFGAGSARQNPSGSSSPFPRPPLPPTPSRALDDKPPPPPPPVGNRPSMHREAVPPPPSQTSKPPVPSTPRPGLGSQAPPPPPPPSRPGPPPLPPASNDEIPRLPQRNLSLTSSAPPLPSPGRSGPLPPPPSERPPPPVRDPPGRSGPLPPPPPINRNGSTARALPATPQLPSRSGMDSPRSGPRPPLPPDRPGAGAPPPPPPSTSVRNGFQDSSCEDEWESRFYFHPISDLPPPEPYVPTTKTYPSKLARNESRSGSNRRERGAPPLPPIPR DIP protein Q8K1I7 original sequence version: 101 0BADBE69463B5960 src8_human Src substrate cortactin CTTN EMS1 Amplaxin Oncogene EMS1 protein protein human Homo sapiens Human MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ DIP protein Q14247 original sequence version: 148 7799326C2B4383BB wipf1_human WAS/WASL-interacting protein family member 1 WIPF1 WIP Wiskott-Aldrich syndrome protein-interacting protein Protein PRPL-2 WASPIP protein protein human Homo sapiens Human MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILDKPKGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDNDSGGSRPPLLPPGGRSTSAKPFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSPHNRGSPPVPGGPRQPSPGPTPPPFPGNRGTALGGGSIRQSPLSSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPSPGRSGPLPPPPSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPPDRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRERGAPPLPPIPR DIP protein O43516 original sequence version: 128 DIP protein O43516 original sequence version: 97 DIP protein O43516 original sequence version: 131 09B7A95E6808A46D cttn-waspip-1 1 8 unspecified role unspecified role bait bait sh3 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-915412]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 547-547, sequence length 546 [EBI-915412]489-547 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association cttn-waspip-2 3 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus sufficient to bind sufficient binding region sufficient to bind range range range range Q60598:p.Trp526Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W K Wed May 02 17:29:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp526lys' Tue Jun 30 19:40:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp526Lys' ecoli Escherichia coli (strain K12) physical association physical association nck1-waspip-2 3 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association cttn-waspip-3 2 8 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind range range range range Q60598:p.Trp526Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W K Wed May 02 16:20:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp526lys' Tue Jun 30 16:15:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp526Lys' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction nck1-waspip-3 2 11 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association cttn-waspip-4 2 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q60598:p.Trp526Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W K Wed May 02 16:01:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp526lys' Tue Jun 30 19:28:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp526Lys' ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction The Kd was estimated by adding different amount of GST-cortactin to a fixed amount of WIP and plotting the amount of bound proteins. cttn-waspip-5 4 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association over-expressed level. O43516 cttn-waspip-6 5 6 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association over-expressed level. O43516 FLAG-WIP fragment 237-503 and FLAG-WIP delta 110-170 did not colocalize with cortactin. WIP and cortactin associate at the cell periphery and the cortactin binding region of WIP seems to be required for efficient cortical localization.