UniProt UniProt http://www.uniprot.org The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins. The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins. J. Cell Biol. (0021-9525) 2002 imex curation Suvorova ES., Duden R., Lupashin VV. lupashinvladimirv@uams.edu 24-AUG-2004: Contacted by JYOTI Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap fingerprinting peptide massfingerprinting fingerprinting Suvorova ES., Duden R., Lupashin VV. lupashinvladimir@uams.edu lupashinvladimirv@uams.edu Accepted 2006-AUG-4 by JYOTI. 24-AUG-2004: Contacted by JYOTI J. Cell Biol. (0021-9525) 2002 Only protein-protein interactions imex curation The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins. The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins. J. Cell Biol. (0021-9525) 2002 imex curation Suvorova ES., Duden R., Lupashin VV. lupashinvladimirv@uams.edu 24-AUG-2004: Contacted by JYOTI Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Suvorova ES., Duden R., Lupashin VV. lupashinvladimir@uams.edu lupashinvladimirv@uams.edu Accepted 2006-AUG-4 by JYOTI. 24-AUG-2004: Contacted by JYOTI J. Cell Biol. (0021-9525) 2002 Only protein-protein interactions imex curation The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins. The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins. J. Cell Biol. (0021-9525) 2002 imex curation Suvorova ES., Duden R., Lupashin VV. lupashinvladimirv@uams.edu 24-AUG-2004: Contacted by JYOTI Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Suvorova ES., Duden R., Lupashin VV. The native immunoprecipitations were performed from solubilized membrane fractions. lupashinvladimir@uams.edu lupashinvladimirv@uams.edu Accepted 2006-AUG-4 by JYOTI. 24-AUG-2004: Contacted by JYOTI J. Cell Biol. (0021-9525) 2002 Only protein-protein interactions imex curation The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins. The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins. J. Cell Biol. (0021-9525) 2002 imex curation Suvorova ES., Duden R., Lupashin VV. lupashinvladimirv@uams.edu 24-AUG-2004: Contacted by JYOTI Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Suvorova ES., Duden R., Lupashin VV. lupashinvladimir@uams.edu lupashinvladimirv@uams.edu Accepted 2006-AUG-4 by JYOTI. 24-AUG-2004: Contacted by JYOTI J. Cell Biol. (0021-9525) 2002 Only protein-protein interactions imex curation The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins. The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins. J. Cell Biol. (0021-9525) 2002 imex curation Suvorova ES., Duden R., Lupashin VV. lupashinvladimirv@uams.edu 24-AUG-2004: Contacted by JYOTI Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom predetermined predetermined participant predetermined Suvorova ES., Duden R., Lupashin VV. 1B, 5A, 5B, 6B, 6C, 7 lupashinvladimir@uams.edu lupashinvladimirv@uams.edu Accepted 2006-AUG-4 by JYOTI. 24-AUG-2004: Contacted by JYOTI J. Cell Biol. (0021-9525) 2002 Only protein-protein interactions imex curation The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins. The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins. J. Cell Biol. (0021-9525) 2002 imex curation Suvorova ES., Duden R., Lupashin VV. lupashinvladimirv@uams.edu 24-AUG-2004: Contacted by JYOTI Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down predetermined predetermined participant predetermined Suvorova ES., Duden R., Lupashin VV. lupashinvladimir@uams.edu lupashinvladimirv@uams.edu Accepted 2006-AUG-4 by JYOTI. 24-AUG-2004: Contacted by JYOTI J. Cell Biol. (0021-9525) 2002 Only protein-protein interactions imex curation gosr1_yeast Golgi SNAP receptor complex member 1 Golgi SNARE protein 1 GOS1 Protein transport protein GOS1 YHL031C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSQPSFVTIRGKAISLETQTESLLSKYSTFAQTTSSEQTGQEKKIDKQLEGILGQRQDVIDSLTQICDSNPAISASKLSQLHRHKEILQDHWKSFRNIRSSIQQERNRLNLLFSVKNDIANSTTDAPAPIGDADEYIQNETRRIDQSNNVVDRLISQAWETRSQFHSQSNVLNTANNKVLQTLQRIPGVNQLIMKINTRRKKNAFVLATITTLCILFLFFTW 1E833249CCC306C2 sec22_yeast Protein transport protein SEC22 SEC22 SLY2 YLR268W L8479.3 TSL26 Suppressor of loss of YPT1 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIKSTLIYREDGLPLCTSVDNENDPSLFEQKQKVKIVVSRLTPQSATEATLESGSFEIHYLKKSMVYYFVICESGYPRNLAFSYLNDIAQEFEHSFANEYPKPTVRPYQFVNFDNFLQMTKKSYSDKKVQDNLDQLNQELVGVKQIMSKNIEDLLYRGDSLDKMSDMSSSLKETSKRYRKSAQKINFDLLISQYAPIVIVAFFFVFLFWWIFLK 9FA3E34EAAFB9536 9FA3E34EAAFB9536 cog1_yeast Conserved oligomeric Golgi complex subunit 1 COG1 COD3 TFI1 YGL223C SEC36 Component of oligomeric Golgi complex 1 Complexed with DOR1 protein 3 Protein SEC36 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDEVLPLFRDSHIPQIKDYQLELQNDLTKTNEAFQKNLLKNYNKILSLTDSVNDLSLNLKNVDQDFKSLCFNDEKFQLNKLTPLPYQTTTHISPPRDEEKVSIPSQNILVISNWTISINNFCNRIVTSTTPSRIFDELLLNFHELSLIPVPSKFEALVKDKCCRLQKFLVDSMKTLNLTLLQWVKLYNLLNTEFSSKWDDDLLSIFNESLFETLFNDNVQALLISSANSKDHQYHSNQQYKDAIVVDFVNSSTFRDHLIRRTVKEINTHLDTLSTLRAKLKEPETLHKLDIFHDNDTNLNDGTVSPLDDDALKQYIDTAVFYSKGLTNDTTLQIYQTVQPTIEILQNLELYKCPQETLTDLRNKLITQLQEFKTQISSRLPSPLENSTSVVDDFITSYNNHNLLQLVIDQITQLRQQ 65F7EF5B5194D9AB 65F7EF5B5194D9AB copg_yeast Coatomer subunit gamma SEC21 YNL287W N0543 Gamma-coat protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAHTYKKFENSTSGDLPDKMTIYQDCMNTFNESPVNSKRCRLLISRLLRLLAQGETFPQNEATALFFSISKLFQHQNDPLRQAVYLAIKELSGISEDVLMATSSIMKDVQNGSDLIKPDAIRSLTYVLDESTAFSAERLLKSAVVSRHPSISSAALCTSYHLLPISEVTIRRFTNETQEAVLDLKQFPNQHGNSEYYPNSTYISQYHALGLLYQLKKTDKMALLKLVRHFSENNSMKNQLAKVELVKIVNDLIYRDPQLFSQFRPLLSDWLSNKFESVQLETAKLITSFATRNSRLVAPELYAAAISALQSLLTVPRVSSRFAALRILNRISMVSPEKIVVCNPELESLINDSNRNISTYAITTLLKTGTSKNISSLISTITNFIHDVSDDFKIIIIDAVRTLSLNFPQEWKSILNFLIDVLKNSEGGFKFKNSIVEALIDIVSFVPQSKELALENLCDFIEDCEFNEILVRILHLLGKEGPSAPNPSLYVRHIYNRVVLENSIIRSAAVVALSKFALTKNDPTLYESIISLLKRIANDKDDEVRDRATIALEFIDSARNKDDVIAQNLIESKYFYDIPSLESKLSSYISSNTDSFATAFDVNQVRKFTEDEMKAINLKRKQEQIFNQKSETTLDTTPEAESVPEKRADANSFAGPNLDDHQEDLLATKYADELLSIEQIKPFGQLVNSSRAISLTEPEAEFVVRGVKHLFKDNVVLQFNITNTLTDIALDNVSVVCTPEISDEAELEELFTLQVDRLLPSEEAACYVAFKKLDEIVMEGFLNNLTFTTKEINPDTNEPFDGDEGFQDEYEIDSIFLNAGDYVKSSFTGNFSATFDELPCEEVAVFNIQEDLSIQEVVDKIILNSSCLPVESTQFAPSDSNSHTLKLFGKSALTGSKVALQIKMIKSSKGLALKVHGKGEDSLLCSDLVNGLMQ 99DC7D737D4EF761 99DC7D737D4EF761 cog4_yeast Conserved oligomeric Golgi complex subunit 4 COG4 SEC38 YPR105C P8283.16 SGF1 Component of oligomeric Golgi complex 4 Protein SEC38 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEGQKSNASWESSIIEGQLSKNLARYTLLLDKLSTLSQIDKLSEVIANDYAKQSKQLNAFVQQSQSSLNKESRKLELQRTNLTTTLTQFHETVATISSSNARAKAIHDDIETVDQERALVNKTLQFVKDVRTLKNNISLAHSALETKDYLVAATAINEIRSLPDKKLIVSEFAKKVVPSSEIPEEPAILIKNWCKELTSLFQEQFMEATRTQDIKELTLMFKMFPMIGQDVLGLDLYSKYVCDIIADESRKIMSNSMENSTKFQGFFSQVLLHLFKIVSTIINDHSKVIATCYGKKHMVHVMEKVEKEADLQASLILDIFMETRKIERTIHDINEWEHSQKNEDVNIDSNQSDIETDGETEKSSIISIHDLALLIMEFSQILQNWSMYSRFYSVKWNEFSDLHPHVLQPPPPIADGKFALKLKQDKVFDEFQVFVLNHLQRSFRNSISLEELPSLNDLITAVPLNDHDNISYPVTSVLDDLILLVRKNLISVVNTGQFKLLASFLNELVKFFQNRFLVKFMQNKFKLLQSKLASNVSLKRYIPKGEEQSATSRSVSPPANKFSPLSRFTFRGAAASALTNIQSNLQAVVAEDEDSILALHHYLIYLNTLYLSKVYVHRLLSIEILEDDSQRILRDNFPFDNDAAQLQNLIINSEKLVLEQTDKLSKWAVKYLFQNILQNRVRNLLGTVFVNSASSNSSTSNQKNVSRDYSAGSNQKNYITSIEDFEDLSQINSFNSKWNQLIIPYKNILHNEAYAELLSVIVDYIVTTLEQRIWTLEFNELGVTKLDRELSLFIGNMCGLNYNLREKFLKLTQIVLLLGLDDDNFDLTTGDIKDDFNGTFDWVINSQERIKARNMKIDRTQ 22F265AB2AD91533 22F265AB2AD91533 ypt1_yeast GTP-binding protein YPT1 YFL038C YPT1 YP2 Rab GTPase YPT1 Transport GTPase YPT1 Protein YP2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC F8C704F6BF2D227B F8C704F6BF2D227B sed5_yeast Integral membrane protein SED5 SED5 YLR026C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNIKDRTSEFQQSVLSYKKRNKNFREQQRERLQEKESENFANNTTGNGKSVSEFQKKASGIAHEISSTAQLLSKLAVLAKRKPMFNDNPVEIAELSFLIKRKIYAIEQSLVQLSQLKKTDVNGNTSNQSSKQPSAVQHSKNVVNLLNTQMKNISGSFKDVLEERQRLEMANKDRWQKLTTDTGHAPADDQTQSNHAADLTTYNNSNPFMTSLLDESSEKNNNSSNQGELSFPQNDSQLMLMEEGQLSNNVYLQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDDIDLNISGAQRELLKYFDRIKSNRWLAAKVFFIIFVFFVIWVLVN B3192B57269A0B83 B3192B57269A0B83 cog6_yeast Conserved oligomeric Golgi complex subunit 6 COG6 COD2 TFI2 YNL041C N2675 SEC37 Component of oligomeric Golgi complex 6 Complexed with DOR1 protein 2 Protein SEC37 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDFVVDYQTYAMADTATPELPEPEPRLNLTSDAQSQPTGKLDLQFKLPDLQRYSNNNATLPVDNDGAGSKDLHKKMTHYAMSSIDKIQLSNPSKQLGQNSQDEKLSQQESQNFTNYEPKNLDLSKLVSPSSGSNKNTTNLVLSNKLSKILNNYTLINYQATVQLRKSLKVLEENKERLSLDEQKLMNPEYVGTLARRALRTDLESQLLKEHITVLEEFKPIIRRIKRLSSSVEKIQRTSEKLLSNETNEVPTNNVVLQEIDQYRLKAEQLKLKKKILLSIRDRFTLNQVEDDVITNGTIDNIFFEVVKKVINIKDESSFLLTLPNLNAGNALIMGVNEILEKTNKKIFNYLIDFLYSFESSSNLLNDHGTTEQESLNIFRKSLVFLSSDLELFNELLKRVTTLRSKSILDEFLSQFDMNSTTSKPIILSAHDPIRYIGDVLASVHSIIANEADFVKSLFDFQDEDLKDTPISILQQNKTFLKGIDNKLLNDIIQSLSNSCRIRIEQIVRFEENPIINFEIVRLLKLYRVMFERKGIQDDSSIINNLKSLEDISKNRIIGYYEDYMKQTVMAETKNSSDDLLPPEWLSEYMNKLVELFEIYEKTHAAEDEESEDNKLLSSKNLQTIVEQPIKDVLLKQLQTSFPLAKKNEKEKASLLTIEINCFDLIKSRLQPFEGLFAQDDDSRKITIWVCDKLKEYTKQMLTLQIKFLFENTGLDLYSNLVNMIFPVDSVKDELDYDMYLALRDNSLMELDMVRKNVHDKLNYYLPQALTDVQGNLLFKLTSPMIADEICDECFKKLSLFYNIFRKLLIHLYPNKKDQVFEILNFSTDEFDMLIGIDH 6484A40F999AD787 ykt6_yeast Synaptobrevin homolog YKT6 YKT6 YKL196C protein protein yeast Saccharomyces cerevisiae Baker's yeast MRIYYIGVFRSGGEKALELSEVKDLSQFGFFERSSVGQFMTFFAETVASRTGAGQRQSIEEGNYIGHVYARSEGICGVLITDKEYPVRPAYTLLNKILDEYLVAHPKEEWADVTETNDALKMKQLDTYISKYQDPSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKKSNSCCIIM 9BA0E47ED87B096D 9BA0E47ED87B096D cog3_yeast Conserved oligomeric Golgi complex subunit 3 COG3 GRD20 SEC34 Component of oligomeric Golgi complex 3 Protein SEC34 YER157W protein protein yeast Saccharomyces cerevisiae Baker's yeast MARSRKNSLVRDIASHPTIPESQTIVGLLDDSYLFDKLKKLSLAVENSDSLQRTDVSEGCSEVNGSEATTSADVKKTNKYLYYTTYLDQLNIKIDEYKVVLDQTRQVNDQLDSSIKKFRKISQDTGAFIEETKTIYEKQSKLSNLTESIPKALHYFEVLDPIMRRLNHATSPAIVKKSSFTTMLATIDESLRFLDENSDLKDAAAYRIKFKQCLIRACELISHFLTNLLKQTNQEILDKTKNKNSLTGLPSTTRDAFLYSKFYTIADTFKIQVSEIVKRSNEKAYNKYHDELNSILYECFNHYFQTRLRLLTPVIWSHIDEIVVKDKDQGLVKFIQDGKVYFQQLCADEYKLFVEFFPEKECRFKINQWFLQLCEPLYDSIRVRVLKETDICTLCDSVTLFAPYYEFEEGSEEYVKQFTDIQYDKLFEPIVQKVQARLILRVQIYVQQNILSYRPTRDVFMISNRRRKSKTSLQGGNEDATTSDDNPDPLLESYLSSFKNRSILPISPNDADDKSIDSEESTDKISQLQTYYPPLLKTLALLSKIYEMINSVVFDDLAHHVVHDCIVSLRNAYDMVIKSSAGKSDFNNLDISLAYLKNLLMLRDSIQNFNIQYTVNETYLDFSGVEGFFKSLKENGRNVLKKTKSSSILTLARELVPKVVNNMVDARTELISELRNVIKDFTESTSLELIDDTLDINSDEDLLSKNVKLRENIKARLPRIYEQILNYIDDQEIVTNLLDAVQELITQSYSKYYETITELAENGKFAKDQVADVMYLDVFTDFFAKEVADLLRNGDIDTITK C7AFBE99010FE571 C7AFBE99010FE571 cog2_yeast Conserved oligomeric Golgi complex subunit 2 COG2 SEC35 YGR120C G6324 Component of oligomeric Golgi complex 2 Protein SEC35 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDFLNDDELDLDLPVTAEISKELFATEIEKYRESETNGTDVDNFDVDRFLVQKNFHYLPLDSLIRDLSGLSQKMVQTLLEQIRSNYDDYLTFSNTYTDEENETLINLEKTQSDLQKFMTQLDHLIKDDISNTQEIIKDVLEYLKKLDEIYGSLRNHSQLTEALSLGKRLSKSLHEMCGIEPLEEEICSGLIEQLYKLITASRRILESCADSNSPYIHHLRNDYQDLLQEFQISLKILTEKCLENPSSLQNLSLTLVSIIKTA 0ED457A7466F0F53 0ED457A7466F0F53 sec35-comp 1 14 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait c-terminus C-terminus TAP tagged protein SEC35 tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 1A tfi1-sec34 5 16 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein TFI1 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1B tfi1-sec35 5 17 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein TFI1 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1B tfi2-sec35 5 17 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait n-terminus n-terminus GST tagged protein TFI2 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1B tfi2-sec34 5 14 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein TFI2 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 16 unspecified role unspecified role prey prey physical association physical association 1B tfi3-sed5 5 16 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein TFI3 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1B tfi3-sec35 5 17 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein TFI3 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1B sec34-comp 2 11 unspecified role unspecified role neutral component neutral component c-terminus C-terminus TAP tagged protein TFI3 tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 17 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component physical association physical association 2A ypt1-sec34 6 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein YPT1 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 3 The interaction requires the presence of GTP. No significant interaction was observed in presence of GDP. ypt1-sec35 6 17 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein YPT1 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 3 The interaction requires the presence of GTP. No significant interaction was observed in presence of GDP. sec34-sed5 5 13 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein SEC34 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5A sec34-gos1 5 7 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein SEC34 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5A The low specific recovery of SNARE proteins may indicate the transiant nature of interactions between the SEC34/35 complex and the SNARE fusion machinery. sec34-ykt6 5 15 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein SEC34 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5A The low specific recovery of SNARE proteins may indicate the transiant nature of interactions between the SEC34/35 complex and the SNARE fusion machinery. sec34-sec22 5 8 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein SEC34 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5A The low specific recovery of SNARE proteins may indicate the transiant nature of interactions between the SEC34/35 complex and the SNARE fusion machinery. sec34-sed5-1 3 13 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association 6A sec35-sed5 3 13 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association 6A sed5-sec34 5 16 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait n-terminus N-terminus tagged protein SED5 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 6B sed5-sec35 5 17 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait n-terminus N-terminus tagged protein SED5 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 6B sed5-sec34-1 5 16 unspecified role unspecified role prey prey n-terminus N-terminus HA tagged protein SEC34 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 unspecified role unspecified role bait bait n-terminus N-terminus tagged protein SED5 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 6C sec34-sec21 5 10 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein SEC34 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5B tfi1-sed5 5 13 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein TFI1 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 7 tfi2-sed5 5 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein TFI2 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 7 tfi3-sed5-1 5 11 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein TFI3 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 unspecified role unspecified role prey prey physical association physical association 7 sec21-sec35 4 17 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 8