MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Identification of a PDZ domain containing Golgi protein, GOPC, as an interaction partner of frizzled. Identification of a PDZ domain containing Golgi protein, GOPC, as an interaction partner of frizzled. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Yao R., Maeda T., Takada S., Noda T. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Yao R., Maeda T., Takada S., Noda T. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Identification of a PDZ domain containing Golgi protein, GOPC, as an interaction partner of frizzled. Identification of a PDZ domain containing Golgi protein, GOPC, as an interaction partner of frizzled. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Yao R., Maeda T., Takada S., Noda T. in vitro In vitro imaging technique imaging technique microscopy predetermined predetermined participant predetermined Yao R., Maeda T., Takada S., Noda T. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Identification of a PDZ domain containing Golgi protein, GOPC, as an interaction partner of frizzled. Identification of a PDZ domain containing Golgi protein, GOPC, as an interaction partner of frizzled. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Yao R., Maeda T., Takada S., Noda T. yeast Saccharomyces cerevisiae Baker's yeast 2h fragment pooling two hybrid fragment pooling approach 2h fragment pooling predetermined predetermined participant predetermined Yao R., Maeda T., Takada S., Noda T. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Identification of a PDZ domain containing Golgi protein, GOPC, as an interaction partner of frizzled. Identification of a PDZ domain containing Golgi protein, GOPC, as an interaction partner of frizzled. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Yao R., Maeda T., Takada S., Noda T. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yao R., Maeda T., Takada S., Noda T. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Identification of a PDZ domain containing Golgi protein, GOPC, as an interaction partner of frizzled. Identification of a PDZ domain containing Golgi protein, GOPC, as an interaction partner of frizzled. Biochem. Biophys. Res. Commun. (0006-291X) 2001 Yao R., Maeda T., Takada S., Noda T. in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yao R., Maeda T., Takada S., Noda T. Biochem. Biophys. Res. Commun. (0006-291X) 2001 fzd8_mouse Frizzled-8 Fzd8 protein protein mouse Mus musculus Mouse MEWGYLLEVTSLLAALAVLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPPGEQPPSGSGHSRPPGARPPHRGGSSRGSGDAAAAPPSRGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAAGAGAAGAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRCCWASKGAAVGAGAGGSGPGGSGPGPGGGGGHGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV DIP protein Q61091 original sequence version: 123 DIP protein Q61091 original sequence version: 119 DIP protein Q61091 original sequence version: 108 9DB95F068BC45CD8 gopc_mouse Golgi-associated PDZ and coiled-coil motif-containing protein Gopc PDZ protein interacting specifically with TC10 protein protein mouse Mus musculus Mouse MSAGGPCPAGAGGGPGGSSCPVGVSPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQTVSQINHKLEAQLVDLRSELTETQAEKVVLEKEVHEQLLQLHSTQLQLHAKTGQSVDSGAIKAKLSVHSVEDLERELEANKTEKVKEARLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGSGNSGASCKDSSGEMKMLQGYNKKAVRDAHENGDVGAAGESPLDDTAARAAHLHSLHQKKAY 47BB5760BFFB6303 fzd5_mouse Frizzled-5 Fzd5 protein protein mouse Mus musculus Mouse MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSRCCCSSRRGHKSGGAMAAGDYAEASAALTGRTGPPGPTAAYHKQVSLSHV DIP protein Q9EQD0 original sequence version: 103 mint Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Plays a role in yolk sac angiogenesis and in placental vascularization. Binds to Wnt2, Wnt10B, Wnt5A, but not to Wnt2B or Wnt4 5FC03620AF087733 goga1_mouse Golgin subfamily A member 1 Golga1 Golgin-97 protein protein mouse Mus musculus Mouse MFAKLKKKIAEETAVAQRPGGTTRIPRSVSKESVASMGADSGDDFASDGSSSREDLSSQLLRRNEQIRKLEARLSDYAEQVRNLQKIKEKLEIALEKHQDSSMRKFQEQNETFQASRAKMAEGLALALARKDQEWSEKMEQLEKDKRFLTSQLQEVKNQSLSLFQKRDEIDELEGFQQQEISKVKHMLLKKEECLGKMEQELDARTRELNRTQEELVTSNQLSSDLNERLEELQRHCSTLEEQRDHLTASKAGAEHKIVVLEQKEQELQAIIQQHSIDLQKVTAETQEKEKVITHLQEKVIFLEKRLEQNLSGEDHVQELLKEKTVAEQNLEDTRQQLLAARNSHTKALYLLETRVKDLERSLQAAEEQLSQSRNVVADQEAQIQKLITTNQENSLSQQQVLALEQHCRERIHALEAQIEALEQTRVADQIASEQGMLQLQQENVALKESRNECEHSLQHHQLELKKLKDEWSQREIVSVAMAQALEEVRKQREEFQQQATELTAIIEEKNQSLCEKDEALLQKEQELRQLEKGHSSALLQMHKLQRELEALKTCKAQEAMPATTGEDCLPLQGQEPLVISKAMQNSEYELPAAEGTPNGEVGASDLKQLQKEKQDLEQQLIEKNKIMKQMQQRMLELKKTLQKELKIRPDSELFEVREKTGPEIPNMAPSVTNNTDLTDAREINFEYLKHVVLKFMSCRESEAFHLIKAVSVLLNFSQEEENMLKETLEYKMSWFGSKPTPKGSIRPSISNPRIPWS 5F2AECF0D91784D2 fzd8-gopc 3 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-1783018: original sequence: 604-685 : SGKTLESWRALCTRCCWASKGAAVGAGAGGSGPGGSGPGPGGGGGHGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQ tagged molecule tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Stoichiometry: 1.0 7 full dna sequence full identification by DNA sequencing full dna sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Stoichiometry: 1.0 physical association physical association NFA See pag 774 sx homomint mint fzd5-gopc 4 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Stoichiometry: 1.0 physical association physical association F4B mint fzd8-gopc-1 4 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Stoichiometry: 1.0 physical association physical association F4B homomint mint gopc-gopc 4 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Stoichiometry: 1.0 physical association physical association F4C homomint mint fzd5-gopc-1 5 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1783174: original sequence: 523-577 : SGKTLESWRRFTSRCCCSSRRGHKSGGAMAAGDYAEASAALTGRTGPPGPTAAY gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association F5A mint fzd8-gopc-2 5 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1783197: original sequence: 253-384 : VIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVE Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:31:56 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was '683-685' range MINT-1783203: original sequence: 683-685 : SVSYPKQMPLSQ binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-1783189: original sequence: 604-685 : SGKTLESWRALCTRCCWASKGAAVGAGAGGSGPGGSGPGPGGGGGHGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQ Q61091:p.Val685Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:13:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:34:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val685ala' Tue Jun 30 16:01:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val685Ala' range MINT-1783201: original sequence: 685-685 : SYPKQMPLSQ Stoichiometry: 1.0 physical association physical association F5B F5C F5A homomint mint golga1-gopc 1 9 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 7 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization F2 Although the experiment was performed in COS-7 cells the proteins were identified with the murine UP_IDs homomint mint fzd5-gopc-2 2 8 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F6 mint