IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure of the B7-1/CTLA-4 complex that inhibits human immune responses. Crystal structure of the B7-1/CTLA-4 complex that inhibits human immune responses. Nature (0028-0836) 2001 Stamper CC., Zhang Y., Tobin JF., Erbe DV., Ikemizu S., Davis SJ., Stahl ML., Seehra J., Somers WS., Mosyak L. PDBe - Data obtained from the Protein Data Bank Europe in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Stamper CC., Zhang Y., Tobin JF., Erbe DV., Ikemizu S., Davis SJ., Stahl ML., Seehra J., Somers WS., Mosyak L. PDBe - Data obtained from the Protein Data Bank Europe Nature (0028-0836) 2001 ctla4_human Cytotoxic T-lymphocyte protein 4 CTLA4 CD152 Cytotoxic T-lymphocyte-associated antigen 4 protein protein human Homo sapiens Human MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN DIP protein P16410 original sequence version: 178 6F9466FB2E139A5A cd80_human T-lymphocyte activation antigen CD80 CD80 CD28LG CD28LG1 LAB7 Activation B7-1 antigen CTLA-4 counter-receptor B7.1 BB1 protein protein human Homo sapiens Human MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV BA453EE34528B1F4 cd80-ctla4-1 1 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction tetrameric, multimeric working 77.100%, free 74.300% 3A