IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The receptor tyrosine phosphatase-like protein ICA512 binds the PDZ domains of beta2-syntrophin and nNOS in pancreatic beta-cells. The receptor tyrosine phosphatase-like protein ICA512 binds the PDZ domains of beta2-syntrophin and nNOS in pancreatic beta-cells. Eur. J. Cell Biol. (0171-9335) 2000 Ort T., Maksimova E., Dirkx R., Kachinsky AM., Berghs S., Froehner SC., Solimena M. An adult cDNA library was used in this study in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ort T., Maksimova E., Dirkx R., Kachinsky AM., Berghs S., Froehner SC., Solimena M. Figure 6 A. Figure 7 B. Figure 8 A. Annotation to indicate that this entry has been checked and accepted by a senior curator. An adult cDNA library was used in this study Eur. J. Cell Biol. (0171-9335) 2000 The receptor tyrosine phosphatase-like protein ICA512 binds the PDZ domains of beta2-syntrophin and nNOS in pancreatic beta-cells. The receptor tyrosine phosphatase-like protein ICA512 binds the PDZ domains of beta2-syntrophin and nNOS in pancreatic beta-cells. Eur. J. Cell Biol. (0171-9335) 2000 Ort T., Maksimova E., Dirkx R., Kachinsky AM., Berghs S., Froehner SC., Solimena M. An adult cDNA library was used in this study yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ort T., Maksimova E., Dirkx R., Kachinsky AM., Berghs S., Froehner SC., Solimena M. Annotation to indicate that this entry has been checked and accepted by a senior curator. An adult cDNA library was used in this study Eur. J. Cell Biol. (0171-9335) 2000 The receptor tyrosine phosphatase-like protein ICA512 binds the PDZ domains of beta2-syntrophin and nNOS in pancreatic beta-cells. The receptor tyrosine phosphatase-like protein ICA512 binds the PDZ domains of beta2-syntrophin and nNOS in pancreatic beta-cells. Eur. J. Cell Biol. (0171-9335) 2000 Ort T., Maksimova E., Dirkx R., Kachinsky AM., Berghs S., Froehner SC., Solimena M. An adult cDNA library was used in this study rat-rin_m Rat insulinoma (INS-1) cells rin_m Rat insulinoma (INS-1) cells Established from a transplantable pancreatic tumour of the islets of Langerhans. The tumour originated in an irradiated NEDH inhibited albino rat and was maintained by serial transplantation in Nedh rats. After transplantation into athymic nude mice the cell line RIN-m was established from the fourth nude mouse heterotransplant, 9 days after the tumour was removed cells were exposed to cystine-free medium resulting in the complete elimination of fibroblast-like cells. RIN-m cells secrete insulin and somatostatin. High levels of L-dopa-decarboxylase and membrane bound secretory granules were detected. RIN-5F (95090402) was established as a secondary clone from RIN-m. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ort T., Maksimova E., Dirkx R., Kachinsky AM., Berghs S., Froehner SC., Solimena M. Figure 6 B. Figure 8 B . Figure 9 B. Annotation to indicate that this entry has been checked and accepted by a senior curator. An adult cDNA library was used in this study Eur. J. Cell Biol. (0171-9335) 2000 The receptor tyrosine phosphatase-like protein ICA512 binds the PDZ domains of beta2-syntrophin and nNOS in pancreatic beta-cells. The receptor tyrosine phosphatase-like protein ICA512 binds the PDZ domains of beta2-syntrophin and nNOS in pancreatic beta-cells. Eur. J. Cell Biol. (0171-9335) 2000 Ort T., Maksimova E., Dirkx R., Kachinsky AM., Berghs S., Froehner SC., Solimena M. An adult cDNA library was used in this study rat-rin_m Rat insulinoma (INS-1) cells rin_m Rat insulinoma (INS-1) cells Established from a transplantable pancreatic tumour of the islets of Langerhans. The tumour originated in an irradiated NEDH inhibited albino rat and was maintained by serial transplantation in Nedh rats. After transplantation into athymic nude mice the cell line RIN-m was established from the fourth nude mouse heterotransplant, 9 days after the tumour was removed cells were exposed to cystine-free medium resulting in the complete elimination of fibroblast-like cells. RIN-m cells secrete insulin and somatostatin. High levels of L-dopa-decarboxylase and membrane bound secretory granules were detected. RIN-5F (95090402) was established as a secondary clone from RIN-m. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Ort T., Maksimova E., Dirkx R., Kachinsky AM., Berghs S., Froehner SC., Solimena M. Figure 5 d Annotation to indicate that this entry has been checked and accepted by a senior curator. An adult cDNA library was used in this study Eur. J. Cell Biol. (0171-9335) 2000 The receptor tyrosine phosphatase-like protein ICA512 binds the PDZ domains of beta2-syntrophin and nNOS in pancreatic beta-cells. The receptor tyrosine phosphatase-like protein ICA512 binds the PDZ domains of beta2-syntrophin and nNOS in pancreatic beta-cells. Eur. J. Cell Biol. (0171-9335) 2000 Ort T., Maksimova E., Dirkx R., Kachinsky AM., Berghs S., Froehner SC., Solimena M. An adult cDNA library was used in this study yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ort T., Maksimova E., Dirkx R., Kachinsky AM., Berghs S., Froehner SC., Solimena M. Stringent binding conditions applied using 10mM 3-aminotetrazole (3-AT). Figure 1 B Annotation to indicate that this entry has been checked and accepted by a senior curator. An adult cDNA library was used in this study Eur. J. Cell Biol. (0171-9335) 2000 q498t0_rat Snta1 protein protein rat Rattus norvegicus (Rat) Rat QPRNLNEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDTLFLRAKDEASARSWAGAIQAQISTFIPWVKDELQALLTATGTAGSQDIKQIGWLTEQLPSGGTAPTLALLTEKELLLYCSLPQTREALSRPARTAPLIATRLVHSGPSKGSVPYDAELSFALRTGTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCNLSVHIDKGFTLWAAEPGATRAVLLRQPFEKLQMSSDDGMSLLFLDFGGAEGEIQLDLHSCPKTMVFIIHSFLSAKVTRLGLLA 5EEDED08FAF051F0 q13425-2 Beta-2-syntrophin SNTB2 D16S2531E SNT2B2 SNTL 59 kDa dystrophin-associated protein A1 basic component 2 Syntrophin-3 Syntrophin-like Beta2-syntrophin28 protein protein human Homo sapiens Human MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELEPALGPAAAAFNGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLENRQN Lacks domains required for interaction with dystrophin related proteins. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. 45DF36C82C013228 capon_rat Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein Nitric oxide synthase 1 adaptor protein C-terminal PDZ ligand of neuronal nitric oxide synthase protein Nos1ap Capon protein protein rat Rattus norvegicus (Rat) Rat MPSKTKYNLVDDGHDLRIPLHNEDAFQHGISFEAKYVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKKKEWTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSDGSGDPGRQLTGAERVSTATAEETDIDAVEVPLPGNDILEFSRGVTDLDAIGKDGGSHIDTTVSPHPQEPMLAASPRMLLPSSSSSKPPGLGTGTPLSTHHQMQLLQQLLQQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHISLLVKQVQELELKLSGQSTMGSQDSLLEITFRSGALPVLCESTTPKPEDLHSPLLGAGLADFAHPVGSPLGRRDCLVKLECFRFLPAEDNQPMAQGEPLLGGLELIKFRESGIASEYESNTDESEERDSWSQEELPRLLNVLQRQELGDSLDDEIAV 801775EB2BF49EFC sntb2_human Beta-2-syntrophin SNT2B2 SNTB2 D16S2531E SNTL 59 kDa dystrophin-associated protein A1 basic component 2 Syntrophin-3 Syntrophin-like protein protein human Homo sapiens Human MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELEPALGPAAAAFNGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLENRLIELHSPDSRNTLILRCKDTATAHSWFVAIHTNIMALLPQVLAELNAMLGATSTAGGSKEVKHIAWLAEQAKLDGGRQQWRPVLMAVTEKDLLLYDCMPWTRDAWASPCHSYPLVATRLVHSGSGCRSPSLGSDLTFATRTGSRQGIEMHLFRVETHRDLSSWTRILVQGCHAAAELIKEVSLGCMLNGQEVRLTIHYENGFTISRENGGSSSILYRYPFERLKMSADDGIRNLYLDFGGPEGELTMDLHSCPKPIVFVLHTFLSAKVTRMGLLV 53A9F3340DC024ED o55147_rat Utrn protein protein rat Rattus norvegicus (Rat) Rat MAKYGHLEASPDDGQNQFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPINDMFSDLKDGRKLLDLLEGLTGTSLPKERGSTRVHALNNVNRVLQVLHQNNVELVNIGGTDIVDGNPKLTLGLLWSIILHWQVKDVMKDIMSDLQQTNSEKILLSWVRQTTRPYSQVNVLNFTTSWTDGLAFNAVLHRHKPDLFSWDRVVKMSPTERLEHAFSKAHTYLGIEKLLDPEDVAVQLPDKKSIIMYLTSLFEVLPQQVTIDAIREVETLPRKYKKECEGEEINIQSAVLTEEGQSPRAETPSTVTEVDMDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEDVKEQFATHETFMMELSAHQSSVGSVLQAGNQLMTQGTLSDEEEFEIQEQMTLLNARWEALRVESMERQSRLHDALMELQKKQLQQLSGWLTLTEERIQKMESLPVGDDLPSLQNLLEEHKSLQSDLEAEQVKVNSLTHMVVIVDENSGESATAVLEDQLQKLGERWTAVCRWTEERWNRLQEINILWQELLEEQCLLEAWLTEKEEALNKVQTGNFKDQKELGVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQLLSNPKASEKMNSDSEELTQRWDSLVQRLEDSSNQVTQAVAKLGMSQIPQKDLLETVHVREQGMIKKPKQELPPPPPPKKRQIHVDVEAKKKFDATSAELQSWILRSKAALQNTEMNEYKKSQETSGVRKKWKGLEKEQKEKIPQLDELNQTGQILQEQMGKEGLLAEEINDVLERVLLEWKMISQQLEDLGRKIQLQEDINAYFRQLDALEKTIRAKEEWLRDASFSESPQRSLPSLKDSCQRELTDLLGLHPRIEILCASCSALRSQPSVPGFVQQGFDDLRRHYQAVQKALEEYQQQLENELKSQPEPAYLDTLNTLKKMLSESEKAAQASLSALNDPSAVEQALQEKKALDETLENQKPTLHKLSEETKALEKNMLPDVGKTYRQEFDDAQGKWNKVKTKVSRDLRSLEEIIPRLRDFKADSEVIEKWTNGVKDFLMKEQAAQGDTTALQRQLDQCTTFANEIETIESSLKNLRDIETSLQRCPVTGVKTWVQTRLADYQSQLEKFSQEIDIQKSRLSDSQEKAMNLKKDLAEMQEWMAQAEEDYLERDFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDSIKLVAARVPSGGQELTSEFNEVLESYQLLCNRIRGKCHTLEEVWSCWVELLHYLDLETAWLNTLEERMQSTEALPERAEAVHDALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEAFNSRYEELSHLAESKQISLEKQLQVLRETDHMLQVLKESLGELDKQLTTYLTDRIDAFQLPQEAQKIQAEISAHELTLEELKKNVRPQPPTSPEGRTTRGGSQMDLLQRKLREVSTKFQLFQKPANFEQRMLDCKRVLDGVKAELHVLSVKDVDPDVIQTHLDKCMKLYKTLSEVKLEVETVIKTGRHIVQKQQTDNPKGMDEQLTSLKVLYNDLGAQVTEGKQDLERASQLSRKLKKEAAILSEWLSTTEAELVQKSASEGVIGDLDTEISWAKNILKDLEKRKVDLNTITESSAALQHLVVGSESVLEDTLCVLNAGWSRVRTWTEDWRNTLLNHQNQLEVFDGHVAHISTCLYQAEALLDEIEKKPASKQEEIVKRLLSELSDASIQVENVREQAIVLVNARGSSSRELVEPKLAELGKNFEKVSQHINSAQMLIGQDPAGTVEAVGPFSDLESLESDIENMLKVVEKHLDPSNDEKMDEERAQIEEVLQRGEHLLHEPMEDSKKEKIRLQLLLLHTRYNKIKAIPQRKTIPLSSGIMSSALPADYLVEINKILLTLDDIELSLNIPELNTTVYEDFSFQEDSLKRIKDQLDRLGEQLAAVHEKQPDVILEASGPEAIQIRDMLSQLNAKWDRVNRLYSDRRGSFARAVEEWKQFHCDLDDLTQWLSEAEDLLVGTCAPDGSLDLEKARTHQLELEDGLSSHQPCLIDVNQKGEDIVQRLRPSDASFLKDKLASLNQRWSALVAEVKDLQPRLKGESKQVSGYRKRLDEVVCWLTKVENSVQKRSTPDPEENPWELTDLAQEMDAQAENIKWLNRAELEMLSDKNLSLCERDNLSESLRNVNTMWTKICREVPSLLKTRTQDPCSAPQTRIAAHPNVQKVALVSSASDAPLRGPEISVPADLDKTITELADWLVLIDQMLKSNIVTVGDVKEINKTVSRMKITKADLEQRHPQLDFVFTLAQNLKNKASSSDLRTAITGKLEKLKTQWESTQHGVELRRQQLEDMVVDSLQWDDHREETEELMRKHEARFYMLQQARRDPLSKQVSDNQLLLQELGSGDGVIMAFDNVLQKLLEEYSSDDTRNVEETTEYLKTSWINLKQSIADRQSALEAELRTVQTSRRDLENFVKWLQEAETTANVLADASQRENALQDSVLARQLRQQMLDIQAEIDAHNDIFKSIDGNRQKMVKALGNSEEATMLQHRLDDMNQRWNDLKAKSASIRAHLEASAEKWNRLLASLEELIKWLNMKDEELKKQMPIGGDVPALQLQYDHCKVLRRELKEKEYSVLNAVDQARVFLADQPIEAPEEPRRNPQSKTELTPEERAQKIAKAMRKQSSEVREKWESLNAVTSTWQKQVGKALEKLRDLQGAVDDLDADMKEVEAVRNGWKPVGDLLIDSLQDHIEKTLAFREEIAPINLKVKTMNDLSSQLSPLDLHPSPKMSRQLDDLNMRWKLLQVSVEDRLKQLQEAHRDFGPCSQHFLSTSVQLPWQRSISHNKVPYYINHQTQTTCWDHPKMTELFQSLGDLNNVRFSAYRTAIKIRRLQKALCLDLLELNTTNEVFKQHKLNQNDQLLSVPDVINCLTTTYDGLEQLHKDLVNVPLCVDMCLNWLLNVYDTGRTGKIRVQSLKIGLMSLSKGLLEEKYRCLFKEVAGPTEMCDQRQLGLLLHDAIQIPRQLGEVAAFGGSNIEPSVRSCFQQNNNKPEISVKEFIDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPTTSGEDVRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNLETPITLISMWPEHYDPSQSPQLFHDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGESPVSQPQSPAQILKSVEKEERGELERIIADLEEEQRNLQVEYEQLKEQHLRRGLPLGSPPDSIVSPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPDSDSRINGVSPWASPQHPSLSYSLDPDPGPQSHQAASEDLLAPPHDTSTDLTDVMEQLNSTFPSCSPNVPSRPQAI 74CF4ECC19EC5E63 ptprn_human Receptor-type tyrosine-protein phosphatase-like N PTPRN ICA3 ICA512 PTP IA-2 Islet cell antigen 512 Islet cell autoantigen 3 protein protein human Homo sapiens Human MRRPRRPGGLGGSGGLRLLLCLLLLSSRPGGCSAVSAHGCLFDRRLCSHLEVCIQDGLFGQCQVGVGQARPLLQVTSPVLQRLQGVLRQLMSQGLSWHDDLTQYVISQEMERIPRLRPPEPRPRDRSGLAPKRPGPAGELLLQDIPTGSAPAAQHRLPQPPVGKGGAGASSSLSPLQAELLPPLLEHLLLPPQPPHPSLSYEPALLQPYLFHQFGSRDGSRVSEGSPGMVSVGPLPKAEAPALFSRTASKGIFGDHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGAGRNPGGVVNVGADIKKTMEGPVEGRDTAELPARTSPMPGHPTASPTSSEVQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMRSVLLTLVALAGVAGLLVALAVALCVRQHARQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKALPQ A852B9063D29399D ptprn_rat Receptor-type tyrosine-protein phosphatase-like N 105 kDa islet cell antigen ICA105 PTP IA-2 PTPLP Brain-enriched membrane-associated protein tyrosine phosphatase BEM-3 Ptprn ICA512 protein protein rat Rattus norvegicus (Rat) Rat MRRPRRPGGPAGCGGSEGSGGLRLLVCLLLLSGRPGGCSAISAHGCLFDRRLCSHLEVCIQDGLFGQCQAGVGQARPLLQVTSPVLQRLQGVLRQLMSQGLSWHDDLTQYVISQEMERIPRLRPPEPHPRDRSGSVPRRAGPAGELLSQGNPTGSSPAVQGLSRPPGDGNGAGVGSPLSSLQAELLPPLLEHLLMPPQPPHPSLTYEPALLQPYLFQQFGSRDGSRGSESASGVVGHLAKAEDPVLFSRSLSKAILGTHSGHSFGDLTGPSPAQLFQDSGLLYMAQELPVPGRARAPRLPEEGGSSRAEDSSEGHEEEVLGGHGEKSPPQAVQADVSLQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGTGRHLGGAVNGGADVKKTIEEQMQRGDTADARPPTPLLPGHPTASSTSIKVRQVLSPGFPEPPKTSSPLGISAVLLEKKSPLGQSQPTVVGQPSARPSAEEYGYIVTDQKPLSLVAGVKLLEILAEHVHMTSGSFINISVVGPAVTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQREESAAVLPRQAHGISPMRSLLLTLVALAGVAGLLVALAVALCMRHHSKQRDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGQPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGSSLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKALPQ BCD567DAFFFE2A2B capon_human Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein C-terminal PDZ ligand of neuronal nitric oxide synthase protein Nitric oxide synthase 1 adaptor protein NOS1AP CAPON KIAA0464 protein protein human Homo sapiens Human MPSKTKYNLVDDGHDLRIPLHNEDAFQHGICFEAKYVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKLLLLQKKEWTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPLPGNDVLEFSRGVTDLDAVGKEGGSHTGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQLLQQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHISLLVKQVQELELKLSGQNAMGSQDSLLEITFRSGALPVLCDPTTPKPEDLHSPPLGAGLADFAHPAGSPLGRRDCLVKLECFRFLPPEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWSQEELPRLLNVLQRQELGDGLDDEIAV D969C65E87684A7C ptprn-sntb2 2 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role prey prey physical association physical association ptprn-sntb2-1 5 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ptprn-sntb2-2 4 6 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization The proteins colocalised to the plasma membrane and pools of both proteins colocalised intracellularly. ptprn-sntb2-3 1 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey rat-rin_m Rat insulinoma (INS-1) cells rin_m Rat insulinoma (INS-1) cells Established from a transplantable pancreatic tumour of the islets of Langerhans. The tumour originated in an irradiated NEDH inhibited albino rat and was maintained by serial transplantation in Nedh rats. After transplantation into athymic nude mice the cell line RIN-m was established from the fourth nude mouse heterotransplant, 9 days after the tumour was removed cells were exposed to cystine-free medium resulting in the complete elimination of fibroblast-like cells. RIN-m cells secrete insulin and somatostatin. High levels of L-dopa-decarboxylase and membrane bound secretory granules were detected. RIN-5F (95090402) was established as a secondary clone from RIN-m. physical association physical association A mouse pan-syntrophin antibody (identified as 1351) against the PDZ domain of all syntrophin isoforms was used in this study. ptprn-sntb2-4 3 6 unspecified role unspecified role bait bait rat-rin_m Rat insulinoma (INS-1) cells rin_m Rat insulinoma (INS-1) cells Established from a transplantable pancreatic tumour of the islets of Langerhans. The tumour originated in an irradiated NEDH inhibited albino rat and was maintained by serial transplantation in Nedh rats. After transplantation into athymic nude mice the cell line RIN-m was established from the fourth nude mouse heterotransplant, 9 days after the tumour was removed cells were exposed to cystine-free medium resulting in the complete elimination of fibroblast-like cells. RIN-m cells secrete insulin and somatostatin. High levels of L-dopa-decarboxylase and membrane bound secretory granules were detected. RIN-5F (95090402) was established as a secondary clone from RIN-m. 12 unspecified role unspecified role prey prey rat-rin_m Rat insulinoma (INS-1) cells rin_m Rat insulinoma (INS-1) cells Established from a transplantable pancreatic tumour of the islets of Langerhans. The tumour originated in an irradiated NEDH inhibited albino rat and was maintained by serial transplantation in Nedh rats. After transplantation into athymic nude mice the cell line RIN-m was established from the fourth nude mouse heterotransplant, 9 days after the tumour was removed cells were exposed to cystine-free medium resulting in the complete elimination of fibroblast-like cells. RIN-m cells secrete insulin and somatostatin. High levels of L-dopa-decarboxylase and membrane bound secretory granules were detected. RIN-5F (95090402) was established as a secondary clone from RIN-m. physical association physical association The authors note that mouse pan-syntrophin antibody 135 against the PDZ domain of all syntrophin isoforms failed to immunoprecipitate Q498T0 citing the most likely cause as 'masking of the PDZ domain in protein complexes. ptprn-nos1ap 3 12 unspecified role unspecified role bait bait rat-rin_m Rat insulinoma (INS-1) cells rin_m Rat insulinoma (INS-1) cells Established from a transplantable pancreatic tumour of the islets of Langerhans. The tumour originated in an irradiated NEDH inhibited albino rat and was maintained by serial transplantation in Nedh rats. After transplantation into athymic nude mice the cell line RIN-m was established from the fourth nude mouse heterotransplant, 9 days after the tumour was removed cells were exposed to cystine-free medium resulting in the complete elimination of fibroblast-like cells. RIN-m cells secrete insulin and somatostatin. High levels of L-dopa-decarboxylase and membrane bound secretory granules were detected. RIN-5F (95090402) was established as a secondary clone from RIN-m. 8 unspecified role unspecified role prey prey rat-rin_m Rat insulinoma (INS-1) cells rin_m Rat insulinoma (INS-1) cells Established from a transplantable pancreatic tumour of the islets of Langerhans. The tumour originated in an irradiated NEDH inhibited albino rat and was maintained by serial transplantation in Nedh rats. After transplantation into athymic nude mice the cell line RIN-m was established from the fourth nude mouse heterotransplant, 9 days after the tumour was removed cells were exposed to cystine-free medium resulting in the complete elimination of fibroblast-like cells. RIN-m cells secrete insulin and somatostatin. High levels of L-dopa-decarboxylase and membrane bound secretory granules were detected. RIN-5F (95090402) was established as a secondary clone from RIN-m. physical association physical association sntb2-nos1ap 3 8 unspecified role unspecified role prey prey rat-rin_m Rat insulinoma (INS-1) cells rin_m Rat insulinoma (INS-1) cells Established from a transplantable pancreatic tumour of the islets of Langerhans. The tumour originated in an irradiated NEDH inhibited albino rat and was maintained by serial transplantation in Nedh rats. After transplantation into athymic nude mice the cell line RIN-m was established from the fourth nude mouse heterotransplant, 9 days after the tumour was removed cells were exposed to cystine-free medium resulting in the complete elimination of fibroblast-like cells. RIN-m cells secrete insulin and somatostatin. High levels of L-dopa-decarboxylase and membrane bound secretory granules were detected. RIN-5F (95090402) was established as a secondary clone from RIN-m. 6 unspecified role unspecified role bait bait rat-rin_m Rat insulinoma (INS-1) cells rin_m Rat insulinoma (INS-1) cells Established from a transplantable pancreatic tumour of the islets of Langerhans. The tumour originated in an irradiated NEDH inhibited albino rat and was maintained by serial transplantation in Nedh rats. After transplantation into athymic nude mice the cell line RIN-m was established from the fourth nude mouse heterotransplant, 9 days after the tumour was removed cells were exposed to cystine-free medium resulting in the complete elimination of fibroblast-like cells. RIN-m cells secrete insulin and somatostatin. High levels of L-dopa-decarboxylase and membrane bound secretory granules were detected. RIN-5F (95090402) was established as a secondary clone from RIN-m. physical association physical association The authors note that mouse pan-syntrophin antibody 135 against the PDZ domain of all syntrophin isoforms failed to immunoprecipitate Nos1ap. sntb2-utrn 3 10 unspecified role unspecified role prey prey rat-rin_m Rat insulinoma (INS-1) cells rin_m Rat insulinoma (INS-1) cells Established from a transplantable pancreatic tumour of the islets of Langerhans. The tumour originated in an irradiated NEDH inhibited albino rat and was maintained by serial transplantation in Nedh rats. After transplantation into athymic nude mice the cell line RIN-m was established from the fourth nude mouse heterotransplant, 9 days after the tumour was removed cells were exposed to cystine-free medium resulting in the complete elimination of fibroblast-like cells. RIN-m cells secrete insulin and somatostatin. High levels of L-dopa-decarboxylase and membrane bound secretory granules were detected. RIN-5F (95090402) was established as a secondary clone from RIN-m. 6 unspecified role unspecified role bait bait rat-rin_m Rat insulinoma (INS-1) cells rin_m Rat insulinoma (INS-1) cells Established from a transplantable pancreatic tumour of the islets of Langerhans. The tumour originated in an irradiated NEDH inhibited albino rat and was maintained by serial transplantation in Nedh rats. After transplantation into athymic nude mice the cell line RIN-m was established from the fourth nude mouse heterotransplant, 9 days after the tumour was removed cells were exposed to cystine-free medium resulting in the complete elimination of fibroblast-like cells. RIN-m cells secrete insulin and somatostatin. High levels of L-dopa-decarboxylase and membrane bound secretory granules were detected. RIN-5F (95090402) was established as a secondary clone from RIN-m. physical association physical association ptprn-sntb2-5 1 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction ptprn-nos1ap-1 1 13 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction