UniProt UniProt http://www.uniprot.org A novel Golgi membrane protein is part of a GTPase-binding protein complex involved in vesicle targeting. A novel Golgi membrane protein is part of a GTPase-binding protein complex involved in vesicle targeting. EMBO J. (0261-4189) 2000 imex curation Matern H., Yang X., Andrulis E., Sternglanz R., Trepte HH., Gallwitz D. dgallwi1@gwdg.de 13-SEP-2006: Contacted by JYOTI Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Matern H., Yang X., Andrulis E., Sternglanz R., Trepte HH., Gallwitz D. dgallwil@gwdg.de dgallwi1@gwdg.de Accepted 2006-AUG-25 by DAVET. 13-SEP-2006: Contacted by JYOTI EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation A novel Golgi membrane protein is part of a GTPase-binding protein complex involved in vesicle targeting. A novel Golgi membrane protein is part of a GTPase-binding protein complex involved in vesicle targeting. EMBO J. (0261-4189) 2000 imex curation Matern H., Yang X., Andrulis E., Sternglanz R., Trepte HH., Gallwitz D. dgallwi1@gwdg.de 13-SEP-2006: Contacted by JYOTI Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Matern H., Yang X., Andrulis E., Sternglanz R., Trepte HH., Gallwitz D. dgallwil@gwdg.de dgallwi1@gwdg.de Accepted 2006-AUG-25 by DAVET. 13-SEP-2006: Contacted by JYOTI EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation ypt31_yeast GTP-binding protein YPT31/YPT8 Rab GTPase YPT31 YPT31 YPT8 YER031C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSEDYGYDYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMDLGDSSANGNANGASAPNGPTISLTPTPNENKKANGNNCC EC274E5873138D78 EC274E5873138D78 yif1_yeast Protein transport protein YIF1 YNL263C N0820 YIF1 YIP1-interacting factor 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSYNPYAYATSEQNGVNDRFSHTPQQQRPMQIPRNTPVNGQGNANMNANVNGSGGGFPFQDPRGSMAFQLGQSAFSNFIGQDNFNQFQETVNKATANAAGSQQISTYFQVSTRYVINKLKLILVPFLNGTKNWQRIMDSGNFLPPRDDVNSPDMYMPIMGLVTYILIWNTQQGLKGSFNPEDLYYKLSSTLAFVCLDLLILKLGLYLLIDSKIPSFSLVELLCYVGYKFVPLILAQLLTNVTMPFNLNILIKFYLFIAFGVFLLRSVKFNLLSRSGAEDDDIHVSISKSTVKKCNYFLFVYGFIWQNVLMWLMG 3D1550C65A7D0A92 ypt1_yeast GTP-binding protein YPT1 YFL038C YPT1 YP2 Rab GTPase YPT1 Transport GTPase YPT1 Protein YP2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC F8C704F6BF2D227B F8C704F6BF2D227B yip1_yeast Protein transport protein YIP1 YIP1 YGR172C YPT-interacting protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFYNTSNNANNGGGFYQPSAQFAVPQGSMSFQNTVGSSNTGNDNNLGVAPDPLPVGILHALSTKGYPHEPPLLEEIGINFDHIITKTKMVLIPIRFGSGVPQEILNDSDLAGPLIFFLLFGLFLLMAGKVHFGYIYGVALFGTISLHNLSKLMSNNDTSTQTNLQFFNTASILGYCFLPLCFLSLLGIFHGLNNTTGYVVSVLFVIWSTWTSSGFLNSLLQLQNARLLIAYPLLIFYSVFALMVIFV 64372B4823A0BC5E 64372B4823A0BC5E yif1-yip1 1 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association 2A yif1-ypt1 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 2A The interaction requires the 55 N-terminal residues of YIF1. yif1-ypt31 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 2A The interaction requires the 55 N-terminal residues of YIF1. yif1-yip1-1 1 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association 2B yif1-yip1-2 2 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 2C yif1-yip1-3 2 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 2C