UniProt UniProt http://www.uniprot.org Direct association of LIS1, the lissencephaly gene product, with a mammalian homologue of a fungal nuclear distribution protein, rNUDE. Direct association of LIS1, the lissencephaly gene product, with a mammalian homologue of a fungal nuclear distribution protein, rNUDE. FEBS Lett. (0014-5793) 2000 imex curation Kitagawa M., Umezu M., Aoki J., Koizumi H., Arai H., Inoue K. harai@mol.f.u-tokyo.ac.jp rat liver cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kitagawa M., Umezu M., Aoki J., Koizumi H., Arai H., Inoue K. harai@mol.f.u-tokyo.ac.jp Accepted 2006-OCT-9 by DAVET. rat liver cDNA FEBS Lett. (0014-5793) 2000 Only protein-protein interactions imex curation Direct association of LIS1, the lissencephaly gene product, with a mammalian homologue of a fungal nuclear distribution protein, rNUDE. Direct association of LIS1, the lissencephaly gene product, with a mammalian homologue of a fungal nuclear distribution protein, rNUDE. FEBS Lett. (0014-5793) 2000 imex curation Kitagawa M., Umezu M., Aoki J., Koizumi H., Arai H., Inoue K. harai@mol.f.u-tokyo.ac.jp rat liver cDNA Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kitagawa M., Umezu M., Aoki J., Koizumi H., Arai H., Inoue K. harai@mol.f.u-tokyo.ac.jp Accepted 2006-OCT-9 by DAVET. rat liver cDNA FEBS Lett. (0014-5793) 2000 Only protein-protein interactions imex curation Direct association of LIS1, the lissencephaly gene product, with a mammalian homologue of a fungal nuclear distribution protein, rNUDE. Direct association of LIS1, the lissencephaly gene product, with a mammalian homologue of a fungal nuclear distribution protein, rNUDE. FEBS Lett. (0014-5793) 2000 imex curation Kitagawa M., Umezu M., Aoki J., Koizumi H., Arai H., Inoue K. harai@mol.f.u-tokyo.ac.jp rat liver cDNA Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kitagawa M., Umezu M., Aoki J., Koizumi H., Arai H., Inoue K. harai@mol.f.u-tokyo.ac.jp Accepted 2006-OCT-9 by DAVET. rat liver cDNA FEBS Lett. (0014-5793) 2000 Only protein-protein interactions imex curation g3hvb8_crigr Platelet-activating factor acetylhydrolase IB subunit alpha PAFAH1B1 LIS1 Lissencephaly-1 protein PAF acetylhydrolase 45 kDa subunit PAF-AH alpha I79_014899 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDMNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 4DBF6A24A6B131CD lis1_bovin Platelet-activating factor acetylhydrolase IB subunit beta PAF-AH alpha Lissencephaly-1 protein PAF acetylhydrolase 45 kDa subunit PAFAH1B1 LIS1 PAFAHA protein protein bovin Bos taurus (Bovine) Bovine MVLSQRQRDELNRAIADYLRSNGYEAAYSVFKKEAELDMNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVEDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR FE5C2DF0AB98F3B4 pa1b3_rat Platelet-activating factor acetylhydrolase IB subunit alpha1 PAF acetylhydrolase 29 kDa subunit PAF-AH subunit gamma Platelet-activating factor acetylhydrolase alpha 1 subunit Pafah1b3 Pafahg protein protein rat Rattus norvegicus (Rat) Rat MSGEGENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHSHTAEQVTGGIKAIVQLVNKLQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGYPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGIPLPETAP 5FEC63E2A611670B pa1b2_rat Platelet-activating factor acetylhydrolase IB subunit alpha2 PAF acetylhydrolase 30 kDa subunit PAF-AH subunit beta Platelet-activating factor acetylhydrolase alpha 2 subunit Pafah1b2 Pafahb protein protein rat Rattus norvegicus (Rat) Rat MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDIDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA B4D24048621AB182 nde1_rat Nuclear distribution protein nudE homolog 1 Nde1 Nude Nude1 protein protein rat Rattus norvegicus (Rat) Rat MEDSGKTFGSEEEETNYWRDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQAETRNRDLLSENNRLRMELESVKEKFEMQHSEGYRQISALEDDLAHTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQDKPRTPMPSSGETKRTDMAVQATGSAPSTPITHQGSSSGLNTPETFRCGLGSPSSGTPLTPAARISALNIVGDLLRKVGALESKLASCKNFMYDQSPSRKSGPALGRGTKNRDGIDRRPGSTAVGDKGSGKRLEFAKPSSQLSSPALPSTQGVVKLLL 0A5E625751A24058 lis1_nde1_1 1 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association None. nde1_lis1_1 3 8 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n-terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2, 3A Transfection with Optimem. nde1_lis1_2 3 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2, 4A This interaction is inhibited in the presence of Pafah1b2 and Pafah1b3. Transfection with Optimem. pafah1b3_lis1_2 2 5 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 6 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 3B pafah1b2_lis1_1 2 5 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 7 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 3B lis1_pafah1b2 _1 1 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association None.