IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ S100A6 and S100A11 are specific targets of the calcium- and zinc-binding S100B protein in vivo. S100A6 and S100A11 are specific targets of the calcium- and zinc-binding S100B protein in vivo. J. Biol. Chem. (0021-9258) 2000 imex curation Deloulme JC., Assard N., Mbele GO., Mangin C., Kuwano R., Baudier J. jcdeloulme@cea.fr 25-SEP-2006: Contacted by JYOTI. Human brain cDNA library Only protein-protein interactions human-u373_mg Human glioblastoma astrocytoma u373_mg Human glioblastoma astrocytoma confocal microscopy confocal microscopy immunostaining immunostaining Deloulme JC., Assard N., Mbele GO., Mangin C., Kuwano R., Baudier J. jcdeloulme@cea.fr Accepted 2006-SEP-1 by DAVET. 25-SEP-2006: Contacted by JYOTI. Human brain cDNA library J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation S100A6 and S100A11 are specific targets of the calcium- and zinc-binding S100B protein in vivo. S100A6 and S100A11 are specific targets of the calcium- and zinc-binding S100B protein in vivo. J. Biol. Chem. (0021-9258) 2000 imex curation Deloulme JC., Assard N., Mbele GO., Mangin C., Kuwano R., Baudier J. jcdeloulme@cea.fr 25-SEP-2006: Contacted by JYOTI. Human brain cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Deloulme JC., Assard N., Mbele GO., Mangin C., Kuwano R., Baudier J. jcdeloulme@cea.fr Accepted 2006-SEP-1 by DAVET. 25-SEP-2006: Contacted by JYOTI. Human brain cDNA library J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation S100A6 and S100A11 are specific targets of the calcium- and zinc-binding S100B protein in vivo. S100A6 and S100A11 are specific targets of the calcium- and zinc-binding S100B protein in vivo. J. Biol. Chem. (0021-9258) 2000 imex curation Deloulme JC., Assard N., Mbele GO., Mangin C., Kuwano R., Baudier J. jcdeloulme@cea.fr 25-SEP-2006: Contacted by JYOTI. Human brain cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Deloulme JC., Assard N., Mbele GO., Mangin C., Kuwano R., Baudier J. Mating assay used jcdeloulme@cea.fr Accepted 2006-SEP-1 by DAVET. 25-SEP-2006: Contacted by JYOTI. Human brain cDNA library J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation S100A6 and S100A11 are specific targets of the calcium- and zinc-binding S100B protein in vivo. S100A6 and S100A11 are specific targets of the calcium- and zinc-binding S100B protein in vivo. J. Biol. Chem. (0021-9258) 2000 imex curation Deloulme JC., Assard N., Mbele GO., Mangin C., Kuwano R., Baudier J. jcdeloulme@cea.fr 25-SEP-2006: Contacted by JYOTI. Human brain cDNA library Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Deloulme JC., Assard N., Mbele GO., Mangin C., Kuwano R., Baudier J. jcdeloulme@cea.fr Accepted 2006-SEP-1 by DAVET. 25-SEP-2006: Contacted by JYOTI. Human brain cDNA library J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation s10ab_human Protein S100-A11 S100 calcium-binding protein A11 Calgizzarin Metastatic lymph node gene 70 protein S100A11 MLN70 S100C Protein S100-C protein protein human Homo sapiens Human MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT 1729ED680290CFE4 s10a6_human Protein S100-A6 S100A6 CACY S100 calcium-binding protein A6 Calcyclin Prolactin receptor-associated protein Growth factor-inducible protein 2A9 MLN 4 protein protein human Homo sapiens Human MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG 860CBB1416ACBCA1 s100b_human Protein S100-B S100B S100 calcium-binding protein B S-100 protein subunit beta S-100 protein beta chain protein protein human Homo sapiens Human MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE 43815AC212A3AD6B s10a1_human Protein S100-A1 S100 calcium-binding protein A1 S-100 protein subunit alpha S-100 protein alpha chain S100A1 S100A protein protein human Homo sapiens Human MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS AD5E53AF326B25D2 s100b-s100a11-1 2 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 1 s100b-s100a6-1 2 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Table 1 s100a1-s100b-1 2 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Table 1 s100b-s100b-1 2 7 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Table 1 s100b-s100b-2 3 7 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3B s100b-s100b-3 3 7 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3B s100a6-s100a6-1 3 6 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 1B s100a6-s100b-1 3 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P04271:p.Phe88Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 18:39:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe88ala' Tue Jun 30 17:36:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe88Ala' phe88ala required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 3B s100b-s100a6-2 3 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P04271:p.Phe88Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 16:40:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe88ala' Tue Jun 30 17:18:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe88Ala' P04271:p.Phe89Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 15:00:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe89ala' Tue Jun 30 20:17:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe89Ala' physical association physical association s100a11-s100a11-1 3 5 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 1B s100b-s100a11-2 3 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P04271:p.Phe89Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 16:29:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe89ala' Tue Jun 30 15:55:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe89Ala' physical association physical association 3B s100a11-s100b-1 3 7 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P04271:p.Phe89Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 14:58:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe89ala' Tue Jun 30 18:51:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe89Ala' 5 unspecified role unspecified role bait bait physical association physical association 3B s100a1-s100a1-1 3 8 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 1B s100a1-s100b-2 3 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait physical association physical association 1B s100b-s100b-4 4 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 5 s100b-s100a11-3 4 5 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 5 Interaction is stabilised in the presence of either CaCl2 or ZnSO4. s100b-s100a1-1 4 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 5 s100b-s100a6-3 4 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 5 Interaction is stabilised in the presence of either CaCl2 or ZnSO4. s100b-s100a1-2 3 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 1B s100b-s100a11-s100a6 1 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization 7