IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Molecular architecture of the mouse DNA polymerase alpha-primase complex. Molecular architecture of the mouse DNA polymerase alpha-primase complex. Mol. Cell. Biol. (0270-7306) 1999 imex curation Mizuno T., Yamagishi K., Miyazawa H., Hanaoka F. Using an IRES derived from poliovirus, plasmids were designed to coexpress p180 and p68 and also p54 and p46. These are then suitable for the transfection of three or four subunits simultaneously because all of the cells expressing p180 will contain p68 and all of the cells expressing p54 will contain p46 at constant ratios. 1C, 2B, 2C, 3B fhanaoka@imcb.osaka-u.ac.jp Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells cosedimentation cosedimentation western blot western blot Immuno blot Immuno blot Mizuno T., Yamagishi K., Miyazawa H., Hanaoka F. Using an IRES derived from poliovirus, plasmids were designed to coexpress p180 and p68 and also p54 and p46. These are then suitable for the transfection of three or four subunits simultaneously because all of the cells expressing p180 will contain p68 and all of the cells expressing p54 will contain p46 at constant ratios. 1C, 2B, 2C, 3B fhanaoka@imcb.osaka-u.ac.jp Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 1999 Only protein-protein interactions imex curation Molecular architecture of the mouse DNA polymerase alpha-primase complex. Molecular architecture of the mouse DNA polymerase alpha-primase complex. Mol. Cell. Biol. (0270-7306) 1999 imex curation Mizuno T., Yamagishi K., Miyazawa H., Hanaoka F. Using an IRES derived from poliovirus, plasmids were designed to coexpress p180 and p68 and also p54 and p46. These are then suitable for the transfection of three or four subunits simultaneously because all of the cells expressing p180 will contain p68 and all of the cells expressing p54 will contain p46 at constant ratios. 1C, 2B, 2C, 3B fhanaoka@imcb.osaka-u.ac.jp Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Mizuno T., Yamagishi K., Miyazawa H., Hanaoka F. Using an IRES derived from poliovirus, plasmids were designed to coexpress p180 and p68 and also p54 and p46. These are then suitable for the transfection of three or four subunits simultaneously because all of the cells expressing p180 will contain p68 and all of the cells expressing p54 will contain p46 at constant ratios. 1C, 2B, 2C, 3B fhanaoka@imcb.osaka-u.ac.jp Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 1999 Only protein-protein interactions imex curation Molecular architecture of the mouse DNA polymerase alpha-primase complex. Molecular architecture of the mouse DNA polymerase alpha-primase complex. Mol. Cell. Biol. (0270-7306) 1999 imex curation Mizuno T., Yamagishi K., Miyazawa H., Hanaoka F. Using an IRES derived from poliovirus, plasmids were designed to coexpress p180 and p68 and also p54 and p46. These are then suitable for the transfection of three or four subunits simultaneously because all of the cells expressing p180 will contain p68 and all of the cells expressing p54 will contain p46 at constant ratios. 1C, 2B, 2C, 3B fhanaoka@imcb.osaka-u.ac.jp Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 pull down pull down western blot western blot Immuno blot Immuno blot Mizuno T., Yamagishi K., Miyazawa H., Hanaoka F. Using an IRES derived from poliovirus, plasmids were designed to coexpress p180 and p68 and also p54 and p46. These are then suitable for the transfection of three or four subunits simultaneously because all of the cells expressing p180 will contain p68 and all of the cells expressing p54 will contain p46 at constant ratios. Using an IRES derived from poliovirus, plasmids were designed to coexpress p180 and p68 and also p54 and p46. These are then suitable for the transfection of three or four subunits simultaneously because all of the cells expressing p180 will contain p68 and all of the cells expressing p54 will contain p46 at constant ratios. 1C, 2B, 2C, 3B fhanaoka@imcb.osaka-u.ac.jp Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 1999 Only protein-protein interactions imex curation Molecular architecture of the mouse DNA polymerase alpha-primase complex. Molecular architecture of the mouse DNA polymerase alpha-primase complex. Mol. Cell. Biol. (0270-7306) 1999 imex curation Mizuno T., Yamagishi K., Miyazawa H., Hanaoka F. Using an IRES derived from poliovirus, plasmids were designed to coexpress p180 and p68 and also p54 and p46. These are then suitable for the transfection of three or four subunits simultaneously because all of the cells expressing p180 will contain p68 and all of the cells expressing p54 will contain p46 at constant ratios. 1C, 2B, 2C, 3B fhanaoka@imcb.osaka-u.ac.jp Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Mizuno T., Yamagishi K., Miyazawa H., Hanaoka F. Using an IRES derived from poliovirus, plasmids were designed to coexpress p180 and p68 and also p54 and p46. These are then suitable for the transfection of three or four subunits simultaneously because all of the cells expressing p180 will contain p68 and all of the cells expressing p54 will contain p46 at constant ratios. 1C, 2B, 2C, 3B fhanaoka@imcb.osaka-u.ac.jp Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 1999 Only protein-protein interactions imex curation pri1_mouse DNA primase small subunit DNA primase 49 kDa subunit Prim1 protein protein mouse Mus musculus Mouse MEPFDPAELPELLKLYYRRLFPYAQYYRWLNYGGVTKNYFQHREFSFTLKDDIYIRYQSFNNQSELEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICSKCWTLMTMAMRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLNEKVHPFVRKSINIIKKYFEEYALVGQDILENKENWDKILALVPETIHDELQRGFQKFHSSPQRWEHLRKVANSSQNMKNDKCGPWLEWEVMLQYCFPRLDVNVSKGVNHLLKSPFSVHPKTGRISVPIDFHKVDQFDPFTVPTISAICRELDMVSTHEKEKEENEADSKHRVRGYKKTSLAPYVKVFEQFLENLDKSRKGELLKKSDLQKDF 54EBF4DA4DE47D8A dpola_mouse DNA polymerase alpha catalytic subunit Pola1 Pola DNA polymerase alpha catalytic subunit p180 protein protein mouse Mus musculus Mouse MAPMHEEDCKLEASAVSDSGSFAASRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDLTSVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDTCGKGSDGKAHRKDRKDVKKPSVTKPNNIKAMFIASAGKKTTDKAVDLSKDDLLGDILQDLNTETAQITPPPVLIPKKKRSTGALLNPFSVHTPKAIPSGKPASPVLRNEPLLTPIPLKRAELAGELAQPECPEDEQELGVMEFEDGDFDESMDTEKVDEKPVTAKTWDQETEPVERVEHEADPERGTTSYLENFLPDVSCWDIDQDDESIPQEVQVDSSNLPLVKGADDEQVFQFYWLDAYEDPYNQPGVVFLFGKVWIESVKTHVSCCVMVKNIERTLYFLPREMKFDLNTGKETAIPVTMKDVYEEFDSKISAKYKIMKFKSKIVEKNYAFEIPDVPEKSEYLEVRYSAEVPQLPQNLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKNPQLLNQPISWCKFEVMALKPDLVNVIKDVSPPPLVVMSFSMKTMQNVQNHQHEIIAMAALVHHSFALDKAPPEPPFQTHFCVVSKPKDCIFPCDFKEVISKKNMKVEIAATERTLIGFFLAKVHKIDPDILVGHNICSFELEVLLQRINECKVPYWSKIGRLRRSNMPKLGSRSGFGERNATCGRMICDVEISAKELIHCKSYHLSELVQQILKTERIVIPTENIRNMYSESSYLLYLLEHIWKDARFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKKATYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVTSEVQKATEDEEQEQIPELPDPNLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLVLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKDMVQKMNLEVIYGDTDSIMINTNSTNLEEVFKLGNKVKSEVNKLYKLLEIDIDAVFKSLLLLKKKKYAALVVEPTSDGNYITKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDRKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLTATQRAYAPEQLQKLDNLAIDTQYYLAQQIHPVVARICEPIDGIDAVLIALWLGLDSTQFRVHQYHKDEENDALLGGPAQLTDEEKYKDCEKFKCLCPSCGTENIYDNVFEGSGLDMEPSLYRCSNVDCKVSPLTFMVQLSNKLIMDIRRCIKKYYDGWLICEEPTCCSRLRRLPLHFSRNGPLCPVCMKAVLRPEYSDKSLYTQLCFYRYIFDADCALEKLTEHEKDKLKKQFFPLRVLQDYRKVKNIAEQFLSWSGYSEVNLSKLFANYAGKS 46D1A9818A7944A3 pri2_mouse DNA primase large subunit DNA primase 58 kDa subunit Prim2 protein protein mouse Mus musculus Mouse MQFSGRIRKKLRLAGDQRNASYPHSLQFYLQPPTENISLTEFENLAFDRVKLLKAIENLGVSYVKGTEQYQSKLEAEIRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEDLRRWFIQQEMDLLRFRFSILPKDKVQSFLKDSHLHFEAISDEEKTLREQDIMASSPSLSGIKLESESVYKVPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRATLSKALALTARSLPAVQSDERLQPLLNHLSHSYTGQDYSTQKNTGKISLDQIDSLSTKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIRGKMDPDKFDKGYSYNIRHSFGKEGKRTDYTPFSCMKIILTNPPGQGDYHGCPFRHSDAELLKQKMQSYKIPASGISQILDLVKGNHYQVACQKYFEMTHNVDDCGFSLNHPNQFFFESQRILTGGKDIKKEISQPETPQHKPSTQKTRDAASALASLDSSLEMDLEGLEEYF 36A64C77669D8C24 dpoa2_mouse DNA polymerase alpha subunit B DNA polymerase alpha 70 kDa subunit Pola2 protein protein mouse Mus musculus Mouse MAVSTQQLAEELQIFGLDYEDSLLEKLAELCVLYRQTEDGMVSELIAFCTSAGKTCLTVDILNSFEYEVLNKKLSKAWHSASKDSGHAGTRDIVSIQELIEAEEEEETLLSSYTTPSKGPLKRVSSTPETPLTKRSVAARSPRQLLSPSSFSPSATPSQKYTSRTNRGEVVTTFGSAQGLSWSGRGGSGSVSLKVVGDPEPLTGSYKAMFQQLMGVREVLTSKIEELGSELKEHHKIEAFTPLLVPAQEPVILLGQIGCDSNGKLNSKSVILEGDQEHSYGAQIPVDLSELKEYSLFPGQVVIMEGFNTTGRRLTATKLYEGVPLPFYQPTEEEGASEQTMVVVACGPYTTSDSITYDPLLDLIAIINRDQPDVCILFGPFLDAKHEQVENCKLTSPFEDVFKQCLRTVIEGTRSSGSHLVFVPSLRDVHHEPVYPQPPFTFSELSREDKKRVQFVSEPCSLSINGVMFGLTSTDLLFHIGAEEIFSSSGTSDRFSRVLKHILTQRSYYPLYPPHEDMAIDYENFYTYAQLPVTPDVFIVPSELRYFVKDIFGCVCVNPGRLTKGQVGGTFGRLYLRRQPKAMDGGGRQGLSVAAQVVRI 79F94443EF33FAA9 prim2-prim1-1 4 5 unspecified role unspecified role neutral component neutral component n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component colocalization colocalization pola-pola2-1 4 8 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization pola-pola2-2 4 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization pola-pola2-3 4 7 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization pola-prim1-4 4 7 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization pola-prim1-5 4 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization pola-prim1-6 2 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association pola-pola2-4 3 6 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P33609:p.[Cys1287Ala;Cys1290Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:24:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys1287ala,cys1290ala' Tue Jun 30 17:59:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys1287Ala;Cys1290Ala]' P33609:p.[Cys1375Ala;Cys1378Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 15:29:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys1375ala,cys1378ala' Tue Jun 30 17:03:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys1375Ala;Cys1378Ala]' 8 unspecified role unspecified role prey prey physical association physical association prim1-pola2-1 2 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait association association P33610 co-expressed in this experiment pola-pola2-5 1 8 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component physical association physical association