UniProt UniProt http://www.uniprot.org Possible involvement of a novel STAM-associated molecule "AMSH" in intracellular signal transduction mediated by cytokines. Possible involvement of a novel STAM-associated molecule "AMSH" in intracellular signal transduction mediated by cytokines. J. Biol. Chem. (0021-9258) 1999 imex curation Tanaka N., Kaneko K., Asao H., Kasai H., Endo Y., Fujita T., Takeshita T., Sugamura K. Lysates of IL-2-stimulated and unstimulated MOLTb cells were treated with a chemical cross-linker, DSP, and then subjected to immunoprecipitation. sugamura@mail.cc.tohoku.ac.jp 13-SEP-2006: Contacted by JYOTI Only protein-protein interactions human-molt-beta Homo sapiens leukemic cell line stably transfected with the IL-2 receptor b chain molt-beta Human T cell leukemic cell line stably transfected with the IL-2 receptor b chain could not find in CABRI etc anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tanaka N., Kaneko K., Asao H., Kasai H., Endo Y., Fujita T., Takeshita T., Sugamura K. Lysates of IL-2-stimulated and unstimulated MOLTb cells were treated with a chemical cross-linker, DSP, and then subjected to immunoprecipitation. sugamura@mail.cc.tohoku.ac.jp Accepted 2006-AUG-24 by ORCHARD. 13-SEP-2006: Contacted by JYOTI J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation Possible involvement of a novel STAM-associated molecule "AMSH" in intracellular signal transduction mediated by cytokines. Possible involvement of a novel STAM-associated molecule "AMSH" in intracellular signal transduction mediated by cytokines. J. Biol. Chem. (0021-9258) 1999 imex curation Tanaka N., Kaneko K., Asao H., Kasai H., Endo Y., Fujita T., Takeshita T., Sugamura K. Lysates of IL-2-stimulated and unstimulated MOLTb cells were treated with a chemical cross-linker, DSP, and then subjected to immunoprecipitation. sugamura@mail.cc.tohoku.ac.jp 13-SEP-2006: Contacted by JYOTI Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tanaka N., Kaneko K., Asao H., Kasai H., Endo Y., Fujita T., Takeshita T., Sugamura K. Lysates of IL-2-stimulated and unstimulated MOLTb cells were treated with a chemical cross-linker, DSP, and then subjected to immunoprecipitation. sugamura@mail.cc.tohoku.ac.jp Accepted 2006-AUG-24 by ORCHARD. 13-SEP-2006: Contacted by JYOTI J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation stam1_human Signal transducing adapter molecule 1 STAM STAM1 protein protein human Homo sapiens Human MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNAQMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVYSPPPAATAAAATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL DIP protein Q92783 original sequence version: 82 8D6F07FAE538F36F stabp_human STAM-binding protein AMSH STAMBP Associated molecule with the SH3 domain of STAM Endosome-associated ubiquitin isopeptidase protein protein human Homo sapiens Human MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR DIP protein O95630 original sequence version: 125 DIP protein O95630 original sequence version: 88 DIP protein O95630 original sequence version: 103 7B6E08A245BD9D43 stambp-stam-1 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Interaction is not dependent on IL-2 stimulation. 3 Association of endogenous AMSH with STAM. stambp-stam-2 2 3 unspecified role unspecified role prey prey sh3 domain binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association 4B stambp-stam-3 2 4 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 3 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association 4 D