IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. J. Neurosci. (0270-6474) 1998 Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 1998 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. J. Neurosci. (0270-6474) 1998 Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 1998 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. J. Neurosci. (0270-6474) 1998 Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 1998 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. J. Neurosci. (0270-6474) 1998 Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 1998 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. J. Neurosci. (0270-6474) 1998 Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 1998 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. J. Neurosci. (0270-6474) 1998 Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). gamma GT11 brain rat cDNA library was used J. Neurosci. (0270-6474) 1998 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. J. Neurosci. (0270-6474) 1998 Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 1998 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. J. Neurosci. (0270-6474) 1998 Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a rat-brain Rattus norvegicus brain brain Brain [cerebrum] fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 1998 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. J. Neurosci. (0270-6474) 1998 Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 1998 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. J. Neurosci. (0270-6474) 1998 Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Neurosci. (0270-6474) 1998 dlg2_rat Disks large homolog 2 Dlg2 Postsynaptic density protein PSD-93 Channel-associated protein of synapse-110 Dlgh2 protein protein rat Rattus norvegicus (Rat) Rat MFFACYCALRTNVKKYRYQDEDGPHDHSLPRLTHEVRGPELVHVSEKNLSQIENVHGYVLQSHISPLKASPAPIIVNTDTLDTIPYVNGTEIEYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYLKVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPYPHYHLGLLPDSDMTSHSQHSTATRQPSVTLQRAISLEGEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGAGQTVTIIAQYQPEDYARFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVILDGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGDIPGLGDDGYGTKTLRGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLEPLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQCKLVIEEQSGPFIWIPSKEKL F8D414A8B9CF5B09 kcna4_human Potassium voltage-gated channel subfamily A member 4 Voltage-gated potassium channel subunit Kv1.4 HPCN2 Voltage-gated potassium channel HK1 Voltage-gated potassium channel HBK4 KCNA4 KCNA4L Voltage-gated K(+) channel HuKII protein protein human Homo sapiens Human MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGGSHHHHQSRGACTSHDPQSSRGSRRRRRQRSEKKKAHYRQSSFPHCSDLMPSGSEEKILRELSEEEEDEEEEEEEEEEGRFYYSEDDHGDECSYTDLLPQDEGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLVMALSAGGHGGLLNDTSAPHLENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLGTDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV 5E511DB704CCA013 apc_rat Adenomatous polyposis coli protein Apc protein protein rat Rattus norvegicus (Rat) Rat MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTELETEASNMKEVLKQLQGSIEDETMTSGQIDLLERLKEFNLDSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRRAFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSLQTDMTRRQLEYEARQIRAAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRVRQLLQSQAAEAERSSQSKHETASHEAERQLEGQGVAESNLATSGSGQSSAARVDHETAGVLSSSGTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCWEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQVDCEMHGLTDDHYSVTLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQNLYGDYVFDASRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGIGLSTYHSATENPGTSSKRGLQLSATAAQIAKVMEEVSALHTSQDDRSPASAAELHCVAEERTAARRSSASHTHPNTHNFAKSESSNRTCSMPYAKVEYKRSSNDSLNSVTSSDGYGKRGQMKPSVESYSEDDEGKFCSYGQYPADLAHKIHSANHMDDNGGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHVIEDEIKQNEQRQSRSQNTNFPVYSENTDDKHLKFQQHFGQQECVSPYRSRGTNGSETNRMGSSHAVNQNVNQSLCQEDDYEDDKPTNYSERYSEEEQHEEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDISSSQKPSFSFSKTPSVQGTKTEHNSPSSEAASAPSSNAKRQSQLHPSSAQRNGQTPKGTACKVPSINQETMQTYCVEDTPICFSRCSSLSSLSSAEDEIGCDQTTQEADSANTLQIAEIKENDVTRSAQDPASDVPAVSQSTRTKPSRLQASGLASESARHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLVFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIVSPSDLPDSPGQTMPPSRSKTPPPPPPPQPVQTKREVPKTKVPAAEQREGGPKQTAVSAAVQRVQVLPDADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETEPEQPEESNENQDKEVEKPDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKLAQTASKLPPPVARKPSQLPVYKLLPSQSRLQAQKHVSFTPGDDVPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGDGVRASVQSGEFEKRDTIPTEGRSTDEAQRGKVSSIAIPDLDGSKAEEGDILAECINSALPKGRSHKPFRVKKIMDQVQQASMTSSGTNKNQIDTKKKKPTSPVKPMPQNTEYRTRVRKNTDSKVNVNTEETFSDNKDSKKQSLKNNPKDLNDKLPDNEDRVRGGFTFDSPHHYAPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKGKESKDSEAKVTCHTEPSSSQQSARKAQASTKHPVNRGPSKPLLQEQPTFPQSSKDVPDRGAATDEKLQNFAIENTPVCFSRNSSLSSLSDVDQENNNNEETGPVRDAEPANAQGQPGKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLRECISSAMPKKRRPSRLKGEGEWQSPRKVGSVLAEDLTLDLKDIQRPESEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAAACLSRQASSDSDSILSLKSGVSLGSPFHLTPDQEEKPFTSHKGPRILKPGEKSTLEAKKIESENKGIKGGKKVYKSLITGKIRSNSEISSQMKQPLQTNMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGPVATTSPRGTKPAVKSELSPITRQTSHISGSNKGPSRSGSRDSTPSRPTQQPLSRPMQSPGRNSISPGRNGISTPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQLSQQNLSKQTGLSKNASSIPRSESASKGLNQMNNSNGSNKKVELSRMSSTKSSGSESDRSERPALVRQSTFIKEAPSPTLRRKLEESASFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHPSVQAGGWRKLPPNLSPTIEYSDGRPSKRHDIARSHSESPSRLPVNRAGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEKHVNSVPGPRQMKENQVPTKGTWRKIKESEISPTNTVSQTTSSGAASGAESKTLIYQMAPAVSRTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSISEKGNPSIKDSKDTQGKQSVGSGSPVQTVGLENRLNSFIQVEAPEQKGTETKAGQGSPAPVAETGETCMAERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVGSSTKKRDSKTDSTESSGAQSPKRHSGSYLVTSV 3CBB2EA8A34E8F47 nos1_rat Nitric oxide synthase, brain Nos1 Bnos BNOS NOS type I Neuronal NOS Constitutive NOS NC-NOS Peptidyl-cysteine S-nitrosylase NOS1 protein protein rat Rattus norvegicus (Rat) Rat MEENTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPSASKDQSLAVDRVTGLGNGPQHAQGHGQGAGSVSQANGVAIDPTMKSTKANLQDIGEHDELLKEIEPVLSILNSGSKATNRGGPAKAEMKDTGIQVDRDLDGKSHKAPPLGGDNDRVFNDLWGKDNVPVILNNPYSEKEQSPTSGKQSPTKNGSPSRCPRFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLPSQHTRKPEDVRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHAFDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKSYKVRFNSVSSYSDSRKSSGDGPDLRDNFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKPNNSLISNDRSWKRNKFRLTYVAEAPDLTQGLSNVHKKRVSAARLLSRQNLQSPKFSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDADEVFSS DIP protein P29476 original sequence version: 172 7255C5AE165200F5 nmde2_rat Glutamate receptor ionotropic, NMDA 2B Grin2b Glutamate [NMDA] receptor subunit epsilon-2 N-methyl D-aspartate receptor subtype 2B protein protein rat Rattus norvegicus (Rat) Rat MKPSAECCSPKFWLVLAVLAVSGSKARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFHHLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTLTPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWIVPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAIITTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHPKLVIILLNKERKWERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVESVDPLSGTCMRNTVPCQKRIISENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHLFYWQFRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILRLLRTAKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFSDYISEVERTFGNLQLKDSNVYQDHYHHHHRPHSIGSTSSIDGLYDCDNPPFTTQPRSISKKPLDIGLPSSKHSQLSDLYGKFSFKSDRYSGHDDLIRSDVSDISTHTVTYGNIEGNAAKRRKQQYKDSLKKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKERSDDFKRDSVSGGGPCTNRSHLKHGTGEKHGVVGGVPAPWEKNLTNVDWEDRSGGNFCRSCPSKLHNYSSTVAGQNSGRQACIRCEACKKAGNLYDISEDNSLQELDQPAAPVAVTSNASSTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRFMDGSPYAHMFEMPAGESSFANKSSVPTAGHHHNNPGSGYMLSKSLYPDRVTQNPFIPTFGDDQCLLHGSKSYFFRQPTVAGASKTRPDFRALVTNKPVVVTLHGAVPGRFQKDICIGNQSNPCVPNNKNPRAFNGSSNGHVYEKLSSIESDV DIP protein Q00960 original sequence version: 102 DIP protein Q00960 original sequence version: 113 DIP protein Q00960 original sequence version: 148 DIP protein Q00960 original sequence version: 158 AEF8B9DF3C1B0D5D kcna4_rat Potassium voltage-gated channel subfamily A member 4 Voltage-gated potassium channel subunit Kv1.4 RCK4 RHK1 RK3 Kcna4 protein protein rat Rattus norvegicus (Rat) Rat MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGTGGSGGGPHHHHQTRGAYSSHDPQGSRGSREEEATRTEKKKKLHHRQSSFPHCSDLMPSGSEEKILRELSEEEEDEEEEEEEEEEGRFYYSEEDHGDGCSYTDLLPQDDGGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLIMALSAGGHSRLLNDTSAPHLENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLGTDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV 40AEF2F901A05F43 dlg1_rat Disks large homolog 1 Dlg1 Synapse-associated protein 97 Dlgh1 protein protein rat Rattus norvegicus (Rat) Rat MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTLLDNPKCVDHSKQCEPVQPGNPWESGSLSSAAVTSESLPGGLSPPVEKYRYQDEEVLPSERISPQVPNEVLGPELVHVSEKSLSEIENVHGFVSHSHISPIKPTEAVPPSSPIVPVTPALPVPAESPVVLPSTPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKRRKAFRKNHEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKAAKPTSMYINDGYAPPDITNSSSQSVDNHVSPSSYLGQTPASPARYSPISKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLRETMMNSSVSSGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRGDKGEIPDDMGSKGLKHVTSNASDSESSYHEYGCSKGGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAKEKL DIP protein Q62696 original sequence version: 129 DIP protein Q62696 original sequence version: 155 18CEBD31DD0CAF8B cript_rat Cysteine-rich PDZ-binding protein Cysteine-rich interactor of PDZ three Cript protein protein rat Rattus norvegicus (Rat) Rat MVCEKCEKKLGRVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV 161D694AC81BFDCB dlg4_rat Disks large homolog 4 Dlg4 Dlgh4 Postsynaptic density protein 95 Synapse-associated protein 90 Psd95 protein protein rat Rattus norvegicus (Rat) Rat MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL DIP protein P31016 original sequence version: 86 DIP protein P31016-1 original sequence version: 148 7922D4E8E0F9AD85 map1a_rat Microtubule-associated protein 1A Map1a Mtap1a protein protein rat Rattus norvegicus (Rat) Rat MDGVAEFSEYVSETVDVPSPFDLLEPPTSGGFLKLSKPCCYIFPGGRGDSALFAVNGFNILVDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKVAELEEEQSQGSSSYSDWVKNLISPELGVVFFNVPDKLRLPDASRKAKRSIEEACLTLQHLNRLGIQAEPLYRVVSNTIEPLTLFHKMGVGRLDMYVLNPVKDSKEMQFLMQKWAGNSKAKTGIVLANGKEAEISVPYLTSITALVVWLPANPTEKIVRVLFPGNAPQNKILEGLEKLRHLDFLRYPVATQKDLAAGAVPANLKPSKIKHRADSKESLKAAPKTAVSKLAKREEVLEEGAKEARSELAKELAKTEKKAKEPSEKPPEKPSKSERVRGESSEALKAEKRRLIKDKAGKKHLKEKISKLEEKKDKEKKEIKKERKELKKEEGRKEEKKDAKKDEKRKDTKPEVKKLSKPDLKPFTPEVRKTLYKAKAPGRVKVDKGRAARGEKELSSEPRTPPAQKGAAPPAAVSGHRELALSSPEDLTQDFEELKREERGLLAEQRDTGLGEKPLPADATEQGHPSAAIQVTQPSGPVLEGEHVEREKEVVPDSPGDKGSTNRGPDSGAEVEKEKETWEERKQREAELGPENTAAREESEAEVKEDVIEKAELEEMEETHPSDEEGEETKAESFYQKHTQEALKASPKSREALGGRDLGFQGKAPEKETASFLSSLATPAGATEHVSYIQDETIPGYSETEQTISDEEIHDEPDERPAPPRFPTSTYDLSGPEGPGPFEASQAADSAVPASSSKTYGAPETELTYPPNMVAAPLAEEEHVSSATSITECDKLSSFATSVAEDQSVASLTAPQTEETGKSSLLLDTVTSIPSSRTEATQGLDYVPSAGTISPTSSLEEDKGFKSPPCEDFSVTGESEKKGETVGRGLSGEKAVGKEEKYVVTSEKLSGQYAAVFGAPGHTLPPGEPALGEVEERCLSPDDSTVKMASPPPSGPPSAAHTPFHQSPVEDKSEPRDFQEDSWGETKHSPGVSKEDSEEQTVKPGPEEGTSEEGKGPPTRSPQAQDMPVSIAGGQTGCTIQLLPEQDKAIVFETGEAGSNLGAGTLPGEVRTSTEEATEPQKDEVLRFTDQSLSPEDAESLSVLSVVSPDTTKQEATPRSPCSLKEQQPHKDLWPMVSPEDTQSLSFSEESPSKETSLDISSKQLSPESLGTLQFGELNLGKEERGPVMKAEDDSCHLAPVSIPEPHRATVSPSTDETPAGTLPGGSFSHSALSVDRKHSPGEITGPGGHFMTSDSSLTKSPESLSSPAMEDLAVEWEGKAPGKEKEPELKSETRQQKGQILPEKVAVVEQDLIIHQKDGALDEENKPGRQQDKTPEQKGRDLDEKDTAAELDKGPEPKEKDLDREDQGQRAGPPAEKDKASEQRDTDLQQTQATEPRDRAQERRDSEEKDKSLELRDRTPEEKDRILVQEDRAPEHSIPEPTQTDRAPDRKGTDDKEQKEEASEEKEQVLEQKDWALGKEGETLDQEARTAEQKDETLKEDKTQGQKSSFVEDKTTTSKETVLDQKSAEKADSVEQQDGAALEKTRALGLEESPAEGSKAREQEKKYWKEQDVVQGWRETSPTRGEPVGGQKEPVPAWEGKSPEQEVRYWRDRDITLQQDAYWRELSCDRKVWFPHELDGQGARPRYCEERESTFLDEGPDEQEITPLQHTPRSPWTSDFKDFQEPLPQKGLEVERWLAESPVGLPPEEEDKLTRSPFEIISPPASPPEMTGQRVPSAPGQESPVPDTESTAPMRNEPTTPSWLAEIPPWVPKDRPLPPAPLSPAPAPPTPAPEPHTPVPFSWGLAEYDSVVAAVQEGAAELEGGPYSPLGKDYRKAEGEREGEGGAGAPDSSSFSPKVPEAGESLATRDTEQTEPEQREPTPYPDERSFQYADIYEQMMLTGLGPACPTREPPLGASGDWPPHLSTKEEAAGCNTSAEKETSSPASPQNLQSDTPAFSYASLAGPAVPPRQEPDPGPNVEPSITPPAVPPRAPISLSKDLSPPLNGSTVSCSPDRRTPSPKETGRGHWDDGTNDSDLEKGAREQPEKETRSPSPHHPMPMGHSSLWPETEAYSSLSSDSHLGSVRPSLDFPASAFGFSSLQPAPPQLPSPAEPRSAPCGSLAFSGDRALALVPGTPTRTRHDEYLEVTKAPSLDSSLPQLPSPSSPGGPLLSNLPRPASPALSEGSSSEATTPVISSVAERFPPGLEAAEQSAEGLGSGKESAAHSLWDLTPLSPAPSASLDLAPAPAPAPAPAPGLPGDLGDGTLPCRPECTGELTKKPSPFLSPSGDHEANGPGETSLNPPGFVTATAEKEEAEAPHAWERGSWPEGAERSSRPDTLLSSEQPLRPGKSSGGPPCSLSSEVEAGPQGCATDPRPHCGELSPSFLNPPLPPSTDDSDLSTEEARLAGKGGRRRVGRPGATGGPCPMADETPPTSASDSGSSQSDSDVPPETEECPSITAEAALDSDEDGDFLPVDKAGGVSGTHHPRPGHDPPPTPLPDPRPSPPRPDVCMADPEGLSSESGRVERLREKGRPGRRAPGRAKPASPARRLDIRGKRSPTPGKGPVDRTSRTVPRPRSTPSQVTSAEEKDGHSPMSKGLVNGLKAGSTALGSKGGSGPPVYVDLAYIPNHCSGKTADQDFFRRVRASYYVVSGNDPANGEPSRAVLDALLEGKAQWGENLQVTLIPTHDTEVTREWYQQTHEQQQQLNVLVLASSSTVVMQDESFPACKIEF DIP protein P34926 original sequence version: 52 3DEF74427BA9D7D7 map1a-dlg4-1 6 20 unspecified role unspecified role prey prey gk binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 19 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction The 3 clones identified in the expression cloning all encode overlapping region of MAP1A now called GK binding region. map1a-dlg4-2 6 20 unspecified role unspecified role prey prey gk binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 19 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction The 3 clones identified in the expression cloning all encode overlapping region of MAP1A now called GK binding region. map1a-dlg4-3 6 20 unspecified role unspecified role prey prey gk binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 19 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction The 3 clones identified in the expression cloning all encode overlapping region of MAP1A now called GK binding region. apc-dlg4-4 6 19 unspecified role unspecified role bait bait pdz domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction map1a-dlg4-4 2 19 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role prey prey gk binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction map1a-dlg4-5 3 19 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] direct interaction direct interaction map1a-dlg4-6 7 20 unspecified role unspecified role prey prey gk binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 19 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gk c-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-631760]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 725-725, sequence length 724 [EBI-631760]701-725 gk n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association map1a-dlg4-7 10 19 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gk c-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association map1a-dlg2-1 10 20 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association map1a-dlg1-1 10 17 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rat-brain Rattus norvegicus brain brain Brain [cerebrum] 20 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association nos1-dlg4-1 10 14 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pdz 1-2-3 domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association map1a-dlg2-2 8 11 unspecified role unspecified role neutral component neutral component 20 unspecified role unspecified role neutral component neutral component colocalization colocalization MAP1A and PSD-93 colocalize in profiles in Purkinje neurones in cerebellum and the CA3 region of hippocampus map1a-dlg2-3 9 11 unspecified role unspecified role bait bait rat-brain Rattus norvegicus brain brain Brain [cerebrum] 20 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association map1a-dlg4-8 4 20 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] 19 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association map1a-dlg4-9 4 19 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association Interaction of MAP1A with PSD-95 full-length can be detected only if other proteins bind to its PDZ domains. PSD-95 GK domain alone binds MAP1A. PDZ domains of PSD-95 full-length inhibit the interaction. The interaction is stimulated by binding of NR2B peptide (KLSSIESDV NMDE2_RAT 1474-1482) to the PDZ domains. map1a-dlg4-10 2 20 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gk binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 19 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction Interaction of MAP1A with PSD-95 full-length can be detected only if other proteins bind to its PDZ domains. PSD-95 GK domain alone binds MAP1A. PDZ domains of PSD-95 full-length inhibit the interaction. The interaction is stimulated by binding of NR2B peptide (KLSSIESDV NMDE2_RAT 1474-1482) to the PDZ domains. kcna4-dlg4-11 10 12 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait pdz 1-2-3 domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Addition of the NR2B peptide (KLSSIESDV NMDE2_RAT 1474-1482) inhibits the interaction. nmde2-dlg4-1 1 15 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-632040]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 1483-1483, sequence length 1482 [EBI-632040]1475-1483 Q00960:p.Val1482Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V A Wed May 02 18:02:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val1482ala' Tue Jun 30 19:31:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1482Ala' chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role bait bait pdz 1-2-3 domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association apc-dlg4-1 1 19 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-632057]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 2843-2843, sequence length 2842 [EBI-632057]2835-2843 chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association cript-dlg4-2 1 18 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-632075]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 102-102, sequence length 101 [EBI-632075]94-102 chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association nmde2-dlg4-2 1 15 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-632082]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 1483-1483, sequence length 1482 [EBI-632082]1475-1483 Q00960:p.Val1482Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V A Wed May 02 18:13:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val1482ala' Tue Jun 30 15:35:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1482Ala' chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association kcna4-dlg4-12 1 16 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-632128]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 656-656, sequence length 655 [EBI-632128]648-656 chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association map1a-dlg4-11 5 19 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role prey prey gk binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 136 134 physical association physical association map1a-dlg4-12 5 20 unspecified role unspecified role prey prey gk binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Interaction of MAP1A with PSD-95 full-length can be detected only if other proteins bind to its PDZ domains. PSD-95 GK domain alone binds MAP1A. The interaction is stimulated by the binding of the following peptides to the PDZ domains which may release an intramolecular inhibition : NR2B peptide (KLSSIESDV NMDE2_RAT 1474-1482), or APC peptide (SGSYLVTSV APC_RAT 2834-2842), or Kv1.4 peptide (NAKAVETDV KCNA4_RAT 647-655) or CRIPT peptide (TKNYKQTSV Q792Q4 1474-1482). Presence of the PDZ domains in PSD-95 inhibits the interaction. It may be through intramolecular inhibition. map1a-dlg2-4 5 20 unspecified role unspecified role prey prey gk binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association No interaction is detected unless NR2B peptide is added (KLSSIESDV NMDE2_RAT 1474-1482). NR2B by binding to PSD-93 PDZ domains may release an intramolecular inhibition. map1a-dlg1-2 5 20 unspecified role unspecified role prey prey gk binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association No interaction is detected unless NR2B peptide is added (KLSSIESDV NMDE2_RAT 1474-1482). NR2B by binding to SAP-97 PDZ domains may release an intramolecular inhibition.