IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ New functional activities for the p21 family of CDK inhibitors. New functional activities for the p21 family of CDK inhibitors. Genes Dev. (0890-9369) 1997 LaBaer J., Garrett MD., Stevenson LF., Slingerland JM., Sandhu C., Chou HS., Fattaey A., Harlow E. labaer@helix.mgh.harvard.edu in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined LaBaer J., Garrett MD., Stevenson LF., Slingerland JM., Sandhu C., Chou HS., Fattaey A., Harlow E. The prey was in vitro translated and 35s radiolabel. The mixture with the bait and the prey was immunoprecipitated, washed and subjected to scintillation counting. labaer@helix.mgh.harvard.edu Genes Dev. (0890-9369) 1997 New functional activities for the p21 family of CDK inhibitors. New functional activities for the p21 family of CDK inhibitors. Genes Dev. (0890-9369) 1997 LaBaer J., Garrett MD., Stevenson LF., Slingerland JM., Sandhu C., Chou HS., Fattaey A., Harlow E. labaer@helix.mgh.harvard.edu in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot LaBaer J., Garrett MD., Stevenson LF., Slingerland JM., Sandhu C., Chou HS., Fattaey A., Harlow E. labaer@helix.mgh.harvard.edu Genes Dev. (0890-9369) 1997 New functional activities for the p21 family of CDK inhibitors. New functional activities for the p21 family of CDK inhibitors. Genes Dev. (0890-9369) 1997 LaBaer J., Garrett MD., Stevenson LF., Slingerland JM., Sandhu C., Chou HS., Fattaey A., Harlow E. labaer@helix.mgh.harvard.edu human-184a1l5 Stable immortalized Homo sapiens cell line derived from normal human mammary epithelial cells 184a1l5 stable immortalized cell line derived from normal human mammary epithelial cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot LaBaer J., Garrett MD., Stevenson LF., Slingerland JM., Sandhu C., Chou HS., Fattaey A., Harlow E. labaer@helix.mgh.harvard.edu Genes Dev. (0890-9369) 1997 New functional activities for the p21 family of CDK inhibitors. New functional activities for the p21 family of CDK inhibitors. Genes Dev. (0890-9369) 1997 LaBaer J., Garrett MD., Stevenson LF., Slingerland JM., Sandhu C., Chou HS., Fattaey A., Harlow E. labaer@helix.mgh.harvard.edu human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot LaBaer J., Garrett MD., Stevenson LF., Slingerland JM., Sandhu C., Chou HS., Fattaey A., Harlow E. labaer@helix.mgh.harvard.edu Genes Dev. (0890-9369) 1997 cdn1c_human Cyclin-dependent kinase inhibitor 1C Cyclin-dependent kinase inhibitor p57 p57Kip2 CDKN1C KIP2 protein protein human Homo sapiens Human MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR A94CCBF09F8CB3E4 cdk4_human Cyclin-dependent kinase 4 CDK4 Cell division protein kinase 4 PSK-J3 protein protein human Homo sapiens Human MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE DIP protein P11802 original sequence version: 177 DIP protein P11802 original sequence version: 135 DIP protein P11802 original sequence version: 136 DIP protein P11802 original sequence version: 200 DIP protein P11802 original sequence version: 86 0916A0C07403A33A cdn1a_human Cyclin-dependent kinase inhibitor 1 CDKN1A CAP20 CDKN1 CIP1 MDA6 PIC1 SDI1 WAF1 p21 CDK-interacting protein 1 Melanoma differentiation-associated protein 6 protein protein human Homo sapiens Human MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP DIP protein P38936 original sequence version: 120 DIP protein P38936 original sequence version: 165 DIP protein P38936 original sequence version: 160 98D1E7C519ADFCA9 ccnd3_human G1/S-specific cyclin-D3 CCND3 protein protein human Homo sapiens Human MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL DIP protein P30281 original sequence version: 150 DIP protein P30281 original sequence version: 111 16E7B1604FEB0029 ccnd1_human G1/S-specific cyclin-D1 CCND1 BCL1 PRAD1 PRAD1 oncogene BCL-1 oncogene B-cell lymphoma 1 protein protein protein human Homo sapiens Human MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI DIP protein P24385 original sequence version: 163 DIP protein P24385 original sequence version: 165 DIP protein P24385 original sequence version: 160 DIP protein P24385 original sequence version: 121 DIP protein P24385 original sequence version: 122 DIP protein P24385 original sequence version: 143 DIP protein P24385 original sequence version: 127 3CC00C9905F58D3A cdn1b_human Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 CDKN1B KIP1 protein protein human Homo sapiens Human MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT DIP protein P46527 original sequence version: 120 DIP protein P46527 original sequence version: 115 DIP protein P46527 original sequence version: 154 DIP protein P46527 original sequence version: 168 DIP protein P46527 original sequence version: 164 DIP protein P46527 original sequence version: 118 1118D58901CDF3FC cdk4-ccnd1-1 4 9 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Overexpression of p21-CIP (P38936) or p27-KIP (P46527) stimulates the complex formation. Overexpression of an amino-terminal 1-90 fragment of p21-CIP (P38936) is sufficient for the stimulation. both proteins are overexpressed cdk4-ccnd1-2 4 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Overexpression of p21-CIP (P38936) or p27-KIP1 (P46527) or p57-KIP2 (P49918) stimulates the complex formation. Overexpression of an amino-terminal 1-90 fragment of p21-CIP (P38936) is sufficient for the stimulation. both proteins are overexpressed cdk4-cdkn1c-1 4 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association both proteins are overexpressed cdk4-cdkn1b-1 4 6 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association both proteins are overexpressed cdk4-cdkn1a-1 4 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association both proteins are overexpressed cdk4-ccnd3-1 4 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Overexpression of p21-CIP (P38936) or p27-KIP1 (P46527) stimulates the complex formation both proteins are overexpressed cdk4-ccnd3-2 4 8 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Overexpression of p21-CIP (P38936) or p27-KIP1 (P46527) stimulates the complex formation both proteins are overexpressed cdk4-ccnd1-3 2 6 unspecified role unspecified role prey prey glu glu tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 9 unspecified role unspecified role bait bait kt3 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Addition of p21-CIP (P38936) or p27-KIP (P46527) stimulates the complex formation. all proteins are purified cdkn1a-ccnd1-1 2 7 unspecified role unspecified role prey prey glu glu tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role bait bait kt3 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association all proteins are purified cdkn1b-ccnd1-2 2 9 unspecified role unspecified role bait bait kt3 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 10 unspecified role unspecified role prey prey glu glu tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association all proteins are purified cdk4-ccnd1-4 1 9 unspecified role unspecified role bait bait kt3 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 6 unspecified role unspecified role prey prey glu glu tag radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 35s radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Addition of p21-CIP (P38936) or p27-KIP (P46527) stimulates the complex formation. Addition of p21-CIP1(P38936) alone increased affinity by 35 fold (2.10E-4 M) by reducing the rate of dissociation Addition of p27-KIP (P46527) alone increased affinity by 80 fold (2.10E-5 M) by reducing the rate of dissociation cdk4-ccnd1-5 3 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Cells were arrested in G0 by depletion of EGF. Reexposure to EGF stimuates synchronous reentery into the cell cycle. The cdk2 interactors could be detected 6 minutes after EGF stimulation. All proteins are endogenous