UniProt UniProt http://www.uniprot.org The transcription factor Spi-1/PU.1 binds RNA and interferes with the RNA-binding protein p54nrb. The transcription factor Spi-1/PU.1 binds RNA and interferes with the RNA-binding protein p54nrb. J. Biol. Chem. (0021-9258) 1996 Hallier M., Tavitian A., Moreau-Gachelin F. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hallier M., Tavitian A., Moreau-Gachelin F. Nuclear extracts have been used. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 1996 The transcription factor Spi-1/PU.1 binds RNA and interferes with the RNA-binding protein p54nrb. The transcription factor Spi-1/PU.1 binds RNA and interferes with the RNA-binding protein p54nrb. J. Biol. Chem. (0021-9258) 1996 Hallier M., Tavitian A., Moreau-Gachelin F. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Hallier M., Tavitian A., Moreau-Gachelin F. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 1996 nono_mouse Non-POU domain-containing octamer-binding protein Nono protein protein mouse Mus musculus Mouse MQSNKAFNLEKQNHTPRKHHQHHHQQHHQQQQQQQQQQPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPPGTPAPPGPATMMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRPAPGAEFAPNKRRRY DIP protein Q99K48 original sequence version: 132 F65E6AE25D471A38 spi1_mouse Transcription factor PU.1 Spi1 Sfpi1 Sfpi-1 31 kDa-transforming protein SFFV proviral integration 1 protein protein protein mouse Mus musculus Mouse MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHYWDFSAHHVHNNEFENFPENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHTGLSHQVSYMPRMCFPYQTLSPAHQQSSDEEEGERQSPPLEVSDGEADGLEPGPGLLHGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRLPPH 765E9CC2F374EB6E nono-spi1-1 2 4 unspecified role unspecified role prey prey 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association nono-spi1-2 2 4 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association nono-spi1-3 1 3 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey physical association physical association