IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification of prion protein binding proteins by combined use of far-Western immunoblotting, two dimensional gel electrophoresis and mass spectrometry. Identification of prion protein binding proteins by combined use of far-Western immunoblotting, two dimensional gel electrophoresis and mass spectrometry. Proteomics (1615-9853) 2006 imex curation Strom A., Diecke S., Hunsmann G., Stuke AW. Whole brain tissue of a PrP knockout mouse was homogenized and cytosolic proteins were separated by sucrose density gradient centrifugation - the fraction containing the PrP-binding proteins was detected and separated by 2-DE. In addition to MALDI-TOF MS analysis, antibodies specific for the identified proteins confirmed the identification of the prey. Figures 2 and 3 and Table 1. astrom@ohri.ca 1532..1534 1532..1544 2006-09-22: Only interaction involving solely Proteins were exported. Only protein-protein interactions 3 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting ms participant Identification by mass spectrometry ms participant Strom A., Diecke S., Hunsmann G., Stuke AW. Whole brain tissue of a PrP knockout mouse was homogenized and cytosolic proteins were separated by sucrose density gradient centrifugation - the fraction containing the PrP-binding proteins was detected and separated by 2-DE. In addition to MALDI-TOF MS analysis, antibodies specific for the identified proteins confirmed the identification of the prey. Figures 2 and 3 and Table 1. astrom@ohri.ca Annotation to indicate that this entry has been checked and accepted by a senior curator. Proteomics (1615-9853) 2006 1532..1534 1532..1544 2006-09-22: Only interaction involving solely Proteins were exported. Only protein-protein interactions 3 imex curation Identification of prion protein binding proteins by combined use of far-Western immunoblotting, two dimensional gel electrophoresis and mass spectrometry. Identification of prion protein binding proteins by combined use of far-Western immunoblotting, two dimensional gel electrophoresis and mass spectrometry. Proteomics (1615-9853) 2006 imex curation Strom A., Diecke S., Hunsmann G., Stuke AW. Whole brain tissue of a PrP knockout mouse was homogenized and cytosolic proteins were separated by sucrose density gradient centrifugation - the fraction containing the PrP-binding proteins was detected and separated by 2-DE. In addition to MALDI-TOF MS analysis, antibodies specific for the identified proteins confirmed the identification of the prey. Figures 2 and 3 and Table 1. astrom@ohri.ca 1532..1534 1532..1544 2006-09-22: Only interaction involving solely Proteins were exported. Only protein-protein interactions 3 human-l-540 Homo sapiens Hodgkin's Lymphoma L-540 cell line l-540 Human Hodgkin's Lymphoma cell line, L-540. far western blotting far western blotting Affinity blotting Affinity blotting ms participant Identification by mass spectrometry ms participant Strom A., Diecke S., Hunsmann G., Stuke AW. Whole brain tissue of a PrP knockout mouse was homogenized and cytosolic proteins were separated by sucrose density gradient centrifugation - the fraction containing the PrP-binding proteins was detected and separated by 2-DE. In addition to MALDI-TOF MS analysis, antibodies specific for the identified proteins confirmed the identification of the prey. Figures 2 and 3 and Table 1. astrom@ohri.ca Annotation to indicate that this entry has been checked and accepted by a senior curator. Proteomics (1615-9853) 2006 1532..1534 1532..1544 2006-09-22: Only interaction involving solely Proteins were exported. Only protein-protein interactions 3 imex curation prio_human Major prion protein PrP27-30 PrP33-35C ASCR PRNP PRIP PRP ALTPRP protein protein human Homo sapiens Human MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPVILLISFLIFLIVG DIP protein P04156 original sequence version: 125 DIP protein P04156 original sequence version: 122 DIP protein P04156 original sequence version: 147 DIP protein P04156 original sequence version: 141 DIP protein P04156 original sequence version: 166 DIP protein P04156-1 original sequence version: 166 43DB596BAAA66484 prio_mouse Major prion protein PrP27-30 PrP33-35C Prnp Prn-p Prp protein protein mouse Mus musculus Mouse MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG DIP protein P04925 original sequence version: 157 DIP protein P04925 original sequence version: 140 DIP protein P04925 original sequence version: 122 DIP protein P04925 original sequence version: 117 DIP protein P04925 original sequence version: 132 DIP protein P04925 original sequence version: 128 D5331E6321826CC0 roa2_human Heterogeneous nuclear ribonucleoproteins A2/B1 HNRNPA2B1 HNRPA2B1 protein protein human Homo sapiens Human MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY DIP protein P22626 original sequence version: 152 DIP protein P22626 original sequence version: 159 4C2560A3D8E99D62 roa2_mouse Heterogeneous nuclear ribonucleoproteins A2/B1 Hnrnpa2b1 Hnrpa2b1 protein protein mouse Mus musculus Mouse MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY EC387DA3D8E989E4 aldoc_mouse Fructose-bisphosphate aldolase C Brain-type aldolase Aldolase 3 Zebrin II Scrapie-responsive protein 2 Aldoc Aldo3 Scrg2 protein protein mouse Mus musculus Mouse MPHSYPALSAEQKKELSDIALRIVTPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGILVGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLKISDRTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEMNGLAAQGRYEGSGDGGAAAQSLYIANHAY 085C58AF163581C6 prnp-aldoc-1 1 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey physical association physical association prnp-hnrpa2b1-1 1 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey physical association physical association prnp-hnrpa2b1-2 2 4 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey physical association physical association 36 kDa.