IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A yeast two-hybrid knockout strain to explore thioredoxin-interacting proteins in vivo. A yeast two-hybrid knockout strain to explore thioredoxin-interacting proteins in vivo. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 Vignols F., Brehelin C., Surdin-Kerjan Y., Thomas D., Meyer Y. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Interactions were quantified accordingly to the yeast growth on medium without histidine and in presence of 3AT : weak (+ or +/-), medium (++), strong (+++), very strong (++++) very strong A yeast strain named CY306 was designed to identify thioredoxin (TRX) targets in vivo by a Y2H approach. CY306 contains a GAL4 reporter sytem but also carries deletions of endogenous genes encoding cytosolic TRXs (TRX1 and TRX2) that presumably compete with TRXs introduced as bait. fig 2, fig 4, table 1 vignols@univ-perp.fr yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down fingerprinting peptide massfingerprinting fingerprinting Vignols F., Brehelin C., Surdin-Kerjan Y., Thomas D., Meyer Y. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Interactions were quantified accordingly to the yeast growth on medium without histidine and in presence of 3AT : weak (+ or +/-), medium (++), strong (+++), very strong (++++) very strong A yeast strain named CY306 was designed to identify thioredoxin (TRX) targets in vivo by a Y2H approach. CY306 contains a GAL4 reporter sytem but also carries deletions of endogenous genes encoding cytosolic TRXs (TRX1 and TRX2) that presumably compete with TRXs introduced as bait. A yeast strain named CY306 was designed to identify thioredoxin (TRX) targets in vivo by a Y2H approach. CY306 contains a GAL4 reporter sytem but also carries deletions of endogenous genes encoding cytosolic TRXs (TRX1 and TRX2) that presumably compete with TRXs introduced as bait. fig 2, fig 4, table 1 vignols@univ-perp.fr Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 A yeast two-hybrid knockout strain to explore thioredoxin-interacting proteins in vivo. A yeast two-hybrid knockout strain to explore thioredoxin-interacting proteins in vivo. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 Vignols F., Brehelin C., Surdin-Kerjan Y., Thomas D., Meyer Y. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Interactions were quantified accordingly to the yeast growth on medium without histidine and in presence of 3AT : weak (+ or +/-), medium (++), strong (+++), very strong (++++) very strong A yeast strain named CY306 was designed to identify thioredoxin (TRX) targets in vivo by a Y2H approach. CY306 contains a GAL4 reporter sytem but also carries deletions of endogenous genes encoding cytosolic TRXs (TRX1 and TRX2) that presumably compete with TRXs introduced as bait. fig 2, fig 4, table 1 vignols@univ-perp.fr yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vignols F., Brehelin C., Surdin-Kerjan Y., Thomas D., Meyer Y. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Interactions were quantified accordingly to the yeast growth on medium without histidine and in presence of 3AT : weak (+ or +/-), medium (++), strong (+++), very strong (++++) very strong very strong A yeast strain named CY306 was designed to identify thioredoxin (TRX) targets in vivo by a Y2H approach. CY306 contains a GAL4 reporter sytem but also carries deletions of endogenous genes encoding cytosolic TRXs (TRX1 and TRX2) that presumably compete with TRXs introduced as bait. A yeast strain named CY306 was designed to identify thioredoxin (TRX) targets in vivo by a Y2H approach. CY306 contains a GAL4 reporter sytem but also carries deletions of endogenous genes encoding cytosolic TRXs (TRX1 and TRX2) that presumably compete with TRXs introduced as bait. fig 2, fig 4, table 1 vignols@univ-perp.fr Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 trxh2_arath Thioredoxin H2 TRX2 At5g39950 MYH19.14 Thioredoxin 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGGALSTVFGSGEDATAAGTESEPSRVLKFSSSARWQLHFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKDELEKKVSKLRA BC034E2BCD4D3CA3 g3p3_yeast Glyceraldehyde-3-phosphate dehydrogenase 3 TDH3 GPD3 YGR192C G7576 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVRVAINGFGRIGRLVMRIALSRPNVEVVALNDPFITNDYAAYMFKYDSTHGRYAGEVSHDDKHIIVDGKKIATYQERDPANLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLNKETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSHSSIFDASAGIQLSPKFVKLVSWYDNEYGYSTRVVDLVEHVAKA 6CFFFEE7061BC36F 6CFFFEE7061BC36F trx2_yeast Thioredoxin-2 TRX2 TRX1 G7746 YGR209C Thioredoxin II Thioredoxin-1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV 071503762C90D451 071503762C90D451 msra_yeast Peptide methionine sulfoxide reductase MXR1 Protein-methionine-S-oxide reductase Peptide-methionine (S)-S-oxide reductase YER042W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSLISKTIKYDPAKDKLITLACGCFWGTEHMYRKYLNDRIVDCKVGYANGEESKKDSPSSVSYKRVCGGDTDFAEVLQVSYNPKVITLRELTDFFFRIHDPTTSNSQGPDKGTQYRSGLFAHSDADLKELAKIKEEWQPKWGNKIATVIEPIKNFYDAEEYHQLYLDKNPQGYACPTHYLREM 329CE3E8F4B006AD if4e_yeast Eukaryotic translation initiation factor 4E CDC33 mRNA cap-binding protein eIF-4F 25 kDa subunit TIF45 YOL139C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVEEVSKKFEENVSVDDTTATPKTVLSDSAHFDVKHPLNTKWTLWYTKPAVDKSESWSDLLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVRPEWEDEANAKGGKWSFQLRGKGADIDELWLRTLLAVIGETIDEDDSQINGVVLSIRKGGNKFALWTKSEDKEPLLRIGGKFKQVLKLTDDGHLEFFPHSSANGRHPQPSITL 5B9162E1BD0B1BDE 5B9162E1BD0B1BDE met16_yeast Phosphoadenosine phosphosulfate reductase MET16 PAdoPS reductase 3'-phosphoadenylylsulfate reductase PAPS reductase, thioredoxin dependent P9325.8 YPR167C protein protein yeast Saccharomyces cerevisiae Baker's yeast MKTYHLNNDIIVTQEQLDHWNEQLIKLETPQEIIAWSIVTFPHLFQTTAFGLTGLVTIDMLSKLSEKYYMPELLFIDTLHHFPQTLTLKNEIEKKYYQPKNQTIHVYKPDGCESEADFASKYGDFLWEKDDDKYDYLAKVEPAHRAYKELHISAVFTGRRKSQGSARSQLSIIEIDELNGILKINPLINWTFEQVKQYIDANNVPYNELLDLGYRSIGDYHSTQPVKEGEDERAGRWKGKAKTECGIHEASRFAQFLKQDA 202AF2C20829513C 202AF2C20829513C ahp1_yeast Peroxiredoxin AHP1 AHP1 Thioredoxin peroxidase type II Cytoplasmic thiol peroxidase 3 Thiol-specific antioxidant II Alkyl hydroperoxide reductase Thioredoxin-dependent peroxiredoxin AHP1 L2916 L9354.5 YLR109W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL 11B730781306A015 11B730781306A015 trx1_yeast Thioredoxin-1 TRX1 TRX2 YLR043C Thioredoxin I Thioredoxin-2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA 87A19FBBBDB20CF5 trxh3_arath Thioredoxin H3 TRX3 At5g42980 MBD2.18 Thioredoxin 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAEGEVIACHTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVVFFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEKHKTVVAAA DIP protein Q42403 original sequence version: 138 7AFCE291C3EB8FE2 tsa1_yeast Peroxiredoxin TSA1 TSA1 TPX1 TSA YML028W Cytoplasmic thiol peroxidase 1 Thiol-specific antioxidant protein 1 ZRG14 Protector protein Thioredoxin peroxidase type Ia Thioredoxin-dependent peroxide reductase Thioredoxin-dependent peroxiredoxin TSA1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAQVQKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAKKFEEQGAQVLFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEGVALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATIKPTVEDSKEYFEAANK 9ACF40E410F2C04A 9ACF40E410F2C04A dld3_yeast D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3 YEL071W DLD3 D-lactate ferricytochrome C oxidoreductase (R)-2-hydroxyglutarate--pyruvate transhydrogenase D-lactate dehydrogenase [cytochrome] 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTAAHPVAQLTAEAYPKVKRNPNFKVLDSEDLAYFRSILSNDEILNSQAPEELASFNQDWMKKYRGQSNLILLPNSTDKVSKIMKYCNDKKLAVVPQGGNTDLVGASVPVFDEIVLSLRNMNKVRDFDPVSGTFKCDAGVVMRDAHQFLHDHDHIFPLDLPSRNNCQVGGVVSTNAGGLNFLRYGSLHGNVLGLEVVLPNGEIISNINALRKDNTGYDLKQLFIGAEGTIGVVTGVSIVAAAKPKALNAVFFGIENFDTVQKLFVKAKSELSEILSAFEFMDRGSIECTIEYLKDLPFPLENQHNFYVLIETSGSNKRHDDEKLTAFLKDTTDSKLISEGMMAKDKADFDRLWTWRKSVPTACNSYGGMYKYDMSLQLKDLYSVSAAVTERLNAAGLIGDAPKPVVKSCGYGHVGDGNIHLNIAVREFTKQIEDLLEPFVYEYIASKKGSISAEHGIGFHKKGKLHYTRSDIEIRFMKDIKNHYDPNGILNPYKYI 4809F74EDF07F520 4809F74EDF07F520 trxb1_yeast Thioredoxin reductase 1 D9476.5 YDR353W TRR1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVHNKVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPDGLTGSELMDRMREQSTKFGTEIITETVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQKGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEILYNTVALEAKGDGKLLNALRIKNTKKNEETDLPVSGLFYAIGHTPATKIVAGQVDTDEAGYIKTVPGSSLTSVPGFFAAGDVQDSKYRQAITSAGSGCMAALDAEKYLTSLE 9F9E58A4BAD859E1 9F9E58A4BAD859E1 adh1_yeast Alcohol dehydrogenase 1 ADH1 ADC1 YOL086C O0947 Alcohol dehydrogenase I YADH-1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIPETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFTKEKDIVGAVLKATDGGAHGVINVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKGQIVGRYVVDTSK F14AE24B5D8D12A5 F14AE24B5D8D12A5 trx1-ahp1-1 2 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait P22217:p.Cys33Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:54:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys33ser' Tue Jun 30 17:46:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys33Ser' physical association physical association author score author-based confidence author score medium trx1-met16-1 2 8 unspecified role unspecified role prey prey P18408:p.Cys245Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:45:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys245ser' Tue Jun 30 16:17:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys245Ser' 10 unspecified role unspecified role bait bait P22217:p.Cys33Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:16:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys33ser' Tue Jun 30 19:30:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys33Ser' physical association physical association author score author-based confidence author score strong trx1-mxr1-2 2 10 unspecified role unspecified role bait bait P22217:p.Cys33Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:16:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys33ser' Tue Jun 30 17:26:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys33Ser' 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score weak trx2-mxr1-3 2 5 unspecified role unspecified role bait bait P22803:p.Cys34Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:02:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys34ser' Tue Jun 30 18:08:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys34Ser' 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score medium trx2-met16-1 2 8 unspecified role unspecified role prey prey P18408:p.Cys245Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:39:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys245ser' Tue Jun 30 16:22:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys245Ser' 5 unspecified role unspecified role bait bait P22803:p.Cys34Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:59:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys34ser' Tue Jun 30 18:12:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys34Ser' physical association physical association author score author-based confidence author score medium trx2-tsa1-1 2 5 unspecified role unspecified role bait bait P22803:p.Cys34Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Thu Jul 07 12:16:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys34ser Wed May 02 16:00:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys34ser' Tue Jun 30 18:54:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys34Ser' 12 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score very strong trx2-ahp1-1 2 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait P22803:p.Cys34Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:06:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys34ser' Tue Jun 30 18:39:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys34Ser' physical association physical association author score author-based confidence author score strong trx3-ahp1-1 2 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait Q42403:p.Cys42Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:22:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys42ser' Tue Jun 30 17:55:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys42Ser' physical association physical association author score author-based confidence author score medium trx3-mrx1-1 2 11 unspecified role unspecified role bait bait Q42403:p.Cys42Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:37:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys42ser' Tue Jun 30 15:42:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys42Ser' 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score weak trx2-mrx1-1 2 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait Q38879:p.Cys62Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:08:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys62ser' Tue Jun 30 18:24:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys62Ser' physical association physical association author score author-based confidence author score weak trx2-met16-2 2 3 unspecified role unspecified role bait bait Q38879:p.Cys62Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 14:31:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys62ser' Tue Jun 30 17:14:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys62Ser' 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score medium trx1-ahp1-2 1 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait P22217:p.Cys33Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:30:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys33ser' Tue Jun 30 17:25:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys33Ser' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association trx2-ahp1-2 1 13 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait P22803:p.Cys34Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:43:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys34ser' Tue Jun 30 18:31:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys34Ser' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association The participant EBI-2382(P38013) was duplicated. It is posssible that originally this interaction did contain more participants pointing to different Trembl proteins which have been merged to a single swissprot protein later. trx2-ahp1-3 1 3 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q38879:p.Cys62Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:32:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys62ser' Tue Jun 30 15:46:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys62Ser' 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association The participant EBI-2382(P38013) was duplicated. It is posssible that originally this interaction did contain more participants pointing to different Trembl proteins which have been merged to a single swissprot protein later. trx3-ahp1-4 1 15 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q42403:p.Cys42Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:55:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys42ser' Tue Jun 30 15:40:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys42Ser' 9 unspecified role unspecified role prey prey association association