MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Bovine PrPC directly interacts with alphaB-crystalline. Bovine PrPC directly interacts with alphaB-crystalline. FEBS Lett. (0014-5793) 2005 Sun G., Guo M., Shen A., Mei F., Peng X., Gong R., Guo D., Wu J., Tien P., Xiao G. no 2009-01-08 in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Sun G., Guo M., Shen A., Mei F., Peng X., Gong R., Guo D., Wu J., Tien P., Xiao G. no FEBS Lett. (0014-5793) 2005 2009-01-08 Bovine PrPC directly interacts with alphaB-crystalline. Bovine PrPC directly interacts with alphaB-crystalline. FEBS Lett. (0014-5793) 2005 Sun G., Guo M., Shen A., Mei F., Peng X., Gong R., Guo D., Wu J., Tien P., Xiao G. no 2009-01-08 in vivo in vivo imaging technique imaging technique microscopy immunostaining immunostaining Sun G., Guo M., Shen A., Mei F., Peng X., Gong R., Guo D., Wu J., Tien P., Xiao G. no FEBS Lett. (0014-5793) 2005 2009-01-08 Bovine PrPC directly interacts with alphaB-crystalline. Bovine PrPC directly interacts with alphaB-crystalline. FEBS Lett. (0014-5793) 2005 Sun G., Guo M., Shen A., Mei F., Peng X., Gong R., Guo D., Wu J., Tien P., Xiao G. no 2009-01-08 yeast Saccharomyces cerevisiae Baker's yeast two hybrid pooling two hybrid pooling approach two hybrid pooling nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sun G., Guo M., Shen A., Mei F., Peng X., Gong R., Guo D., Wu J., Tien P., Xiao G. no FEBS Lett. (0014-5793) 2005 2009-01-08 prio_bovin Major prion protein PRNP PRP Major scrapie-associated fibril protein 1 protein protein bovin Bos taurus (Bovine) Bovine MVKSHIGSWILVLFVAMWSDVGLCKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHGQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGSDYEDRYYRENMHRYPNQVYYRPVDQYSNQNNFVHDCVNITVKEHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQRGASVILFSSPPVILLISFLIFLIVG The function of PrP is not known. PrP is encoded in the host genome and is expressed both in normal and infected cells Found in high quantity in the brain of humans and animals infected with degenerative neurological diseases such as kuru, Creutzfeldt-Jakob disease (CJD), Gerstmann-Straussler syndrome (GSS), scrapie, bovine spongiform encephalopathy (BSE), transmissible mink encephalopathy (TME), etc mint homomint D6D214038316A231 cryab_bovin Alpha-crystallin B chain CRYAB CRYA2 Alpha(B)-crystallin protein protein bovin Bos taurus (Bovine) Bovine MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPASTSLSPFYLRPPSFLRAPSWIDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLAITSSLSSDGVLTVNGPRKQASGPERTIPITREEKPAVTAAPKK DIP protein P02510 original sequence version: 91 May contribute to the transparency and refractive index of the lens mint E0CFBBA8D6DE82B2 prnp-cryab 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 association association F4 0.398 micromolar FEBS-Letters homomint mint cryab-prnp 1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association F3 FEBS-Letters homomint mint prnp-cryab-1 3 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1486087: original sequence: 25-242 : KKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHGQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGSDYEDRYYRENMHRYPNQVYYRPVDQYSNQNNFVHDCVNITVKEHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQRGA Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1 FEBS-Letters homomint mint cryab-prnp-1 2 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Stoichiometry: 1.0 5 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization F2 FEBS-Letters homomint mint