MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Mapping of C-termini of V-ATPase subunits by in vivo-FRET measurements. Mapping of C-termini of V-ATPase subunits by in vivo-FRET measurements. FEBS Lett. (0014-5793) 2005 imex curation Seidel T., Golldack D., Dietz KJ. no 2009-01-08 Only protein-protein interactions in vivo in vivo fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Seidel T., Golldack D., Dietz KJ. no FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation Mapping of C-termini of V-ATPase subunits by in vivo-FRET measurements. Mapping of C-termini of V-ATPase subunits by in vivo-FRET measurements. FEBS Lett. (0014-5793) 2005 imex curation Seidel T., Golldack D., Dietz KJ. no 2009-01-08 Only protein-protein interactions in vivo in vivo imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Seidel T., Golldack D., Dietz KJ. no FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation q9avu8_mescr V-ATPase 69 kDa subunit vatA V-type proton ATPase catalytic subunit A Vacuolar proton pump subunit alpha protein protein mescr Mesembryanthemum crystallinum MPAVYGDRLTTFEDSEKESEYGYIRKVSGPVVVADGMNGAAMYELVRVGYDNLIGEIIRLEGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAKRSGDVYIPRGVAVPPLDKDALWEFEPKKIGEGDLLTGGDLYAKVYENSLMAHRVALPPDAMGKITYIAPPGQYSIQDTVLELEFQGVKKEFTMLQSWPVRTPSPVASKLAADTPLLTGQRVLDALFPSVLGGTCAIPGAFGCGKTVISQALSKYSNSDAVVYVGCGERGNEMAEVLMDFPQLTMTLPDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLAARLASFYERAGKVKCLGGPERTGSVTIVGAVSPPGGDFSDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYTSALETFYEKFDPDFINIRTKAREVLQREDDLNEIVQLVGKDALAETDKITLETAKLLREDYLAQNAFTPYDKFCPFVYKSVWMMRNIIHFYNLANKAVERGAGSDGQKITYSLIKLRLGDLFYRLVSQKFEDPAEGEDTLVAKFQKLYEDLSAAFRNLDDETR mint 126E50DC9CF5EBF3 vate_mescr V-type proton ATPase subunit E VATE Vacuolar proton pump subunit E protein protein mescr Mesembryanthemum crystallinum MNDTDVQNQIQQMVRFMRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKAKQVDVRRKIEYSMQLNASRIKVLQAQDDLVNAMKEAASKELLLVSGDHHQYRNLLKELIVQSLLRLKEPAVLLRCREEDKHHVHRVLHSAREEYGEKACVSHPEVIVDDIHLPPAPTSYDSHELSCSGGVVMASRDGKIVFENTLDARLEVAFRKKLPQIRKQLFAV Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells mint 95ADE39D5835102A q8gub4_mescr V-type proton ATPase subunit G vha-G protein protein mescr Mesembryanthemum crystallinum MEASRAQNGIQLLLAAEQEAQHIINAAKNAKTARLRQAKEEAEKEIAEFRAQMEADHQRRLAESTGDSGANVKRLEQETNAKIEQLKIQASTISPYVVEMLLRYVTSRE mint 535F485007746A52 q8gub3_mescr V-type proton ATPase subunit H vha-H protein protein mescr Mesembryanthemum crystallinum MTIDHAELSTEQVMKRDIPWETYMTTKLISGTSLQLLRRYDKKPESQRASLLDDDGPAYVRVFVNILRDIFKEETVEYVLSLIDEMLTANPKRARLFHDNSLANEDVYEPFIRLLWKGNWFIQEKSCKILALIVSARPKNQSGRAINGEASDSKRKFTTIDDVLKGLSWLALCTAKEAFSSQSGAFLIAVNCLATLLKEPVVRSSFVQADGVKLLVPLINPVSNQSSTPLASSHPNQQSIQLLYETCLCVWLLSFYEPAIEYLATSRTLPRLMEVVKTSTKEKVVRVIVMTFKNLLPRGTFGAQMVDLGMLPLVVQNLKAHAWGDEDLVEALNQLEEGMKENIKKLSSFDKYKQEVLLGHLDWSPVHKDTFFWRDNITNFEENDFQILRVLITILDTSSDPRSLAVCKCEFDLSQFIQNHPAGRMIVNDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQA mint 53CB0B25E4B99079 q8gub5_mescr Vacuolar proton pump subunit B Vacuolar proton pump subunit B vha-B protein protein mescr Mesembryanthemum crystallinum MGAPNNLEMDEGNLEIGMEYRTVSGVAGPLVILEKVKGPKYQEIVNIRLGDGTTRRGQVLEVDGEKAVVQVFEGTSGIDNKYTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQICRQAGLVKRLEKTENLMEGGEEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNLANDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLATIYERAGRIEGRSGSITQIPILAMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRRDHSDVSNQLYANYAIGKDVQAMKAVVGEEALSSEDLLYLEFLDKFERKFVAQGAYDTRTIFQSLDLAWTLLRIFPRELLHRIPAKTLDQYYSRDASN mint 23DB2EE84D20F9CF vha_b-vha_h 1 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 proximity proximity close-contact colocalization neighbourhood interaction F5 FEBS-Letters mint vata-vha_b 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 proximity proximity close-contact colocalization neighbourhood interaction F5 FEBS-Letters mint vate-vha_h 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 proximity proximity close-contact colocalization neighbourhood interaction F5 FEBS-Letters mint vate-vha_b 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 proximity proximity close-contact colocalization neighbourhood interaction F5 FEBS-Letters mint vha_g-vha_g 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 proximity proximity close-contact colocalization neighbourhood interaction F5 FEBS-Letters mint vate-vate 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 proximity proximity close-contact colocalization neighbourhood interaction F5 FEBS-Letters mint vha_b-vha_g 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 proximity proximity close-contact colocalization neighbourhood interaction F5 FEBS-Letters mint vha_b-vha_h-1 2 7 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F4 FEBS-Letters mint