MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Arabidopsis ubiquitin-specific protease 6 (AtUBP6) interacts with calmodulin. Arabidopsis ubiquitin-specific protease 6 (AtUBP6) interacts with calmodulin. FEBS Lett. (0014-5793) 2005 imex curation Moon BC., Choi MS., Kang YH., Kim MC., Cheong MS., Park CY., Yoo JH., Koo SC., Lee SM., Lim CO., Cho MJ., Chung WS. no no status 2009-01-08 Only protein-protein interactions in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Moon BC., Choi MS., Kang YH., Kim MC., Cheong MS., Park CY., Yoo JH., Koo SC., Lee SM., Lim CO., Cho MJ., Chung WS. no no status FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation Arabidopsis ubiquitin-specific protease 6 (AtUBP6) interacts with calmodulin. Arabidopsis ubiquitin-specific protease 6 (AtUBP6) interacts with calmodulin. FEBS Lett. (0014-5793) 2005 imex curation Moon BC., Choi MS., Kang YH., Kim MC., Cheong MS., Park CY., Yoo JH., Koo SC., Lee SM., Lim CO., Cho MJ., Chung WS. no no status 2009-01-08 Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa predetermined predetermined participant predetermined Moon BC., Choi MS., Kang YH., Kim MC., Cheong MS., Park CY., Yoo JH., Koo SC., Lee SM., Lim CO., Cho MJ., Chung WS. no no status FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation Arabidopsis ubiquitin-specific protease 6 (AtUBP6) interacts with calmodulin. Arabidopsis ubiquitin-specific protease 6 (AtUBP6) interacts with calmodulin. FEBS Lett. (0014-5793) 2005 imex curation Moon BC., Choi MS., Kang YH., Kim MC., Cheong MS., Park CY., Yoo JH., Koo SC., Lee SM., Lim CO., Cho MJ., Chung WS. no no status 2009-01-08 Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Moon BC., Choi MS., Kang YH., Kim MC., Cheong MS., Park CY., Yoo JH., Koo SC., Lee SM., Lim CO., Cho MJ., Chung WS. no no status FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation Arabidopsis ubiquitin-specific protease 6 (AtUBP6) interacts with calmodulin. Arabidopsis ubiquitin-specific protease 6 (AtUBP6) interacts with calmodulin. FEBS Lett. (0014-5793) 2005 imex curation Moon BC., Choi MS., Kang YH., Kim MC., Cheong MS., Park CY., Yoo JH., Koo SC., Lee SM., Lim CO., Cho MJ., Chung WS. no no status 2009-01-08 Only protein-protein interactions in vitro In vitro phage display phage display nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Moon BC., Choi MS., Kang YH., Kim MC., Cheong MS., Park CY., Yoo JH., Koo SC., Lee SM., Lim CO., Cho MJ., Chung WS. no no status FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation ubp6_arath Ubiquitin carboxyl-terminal hydrolase 6 UBP6 F19C24.8 At1g51710 Ubiquitin thioesterase 6 Ubiquitin-specific-processing protease 6 Deubiquitinating enzyme 6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPTVSVKWQKKVLDGIEIDVSLPPYVFKAQLYDLTGVPPERQKIMVKGGLLKDDGDWAAIGVKDGQKLMMMGTADEIVKAPEKAIVFAEDLPEEALATNLGYSAGLVNLGNTCYMNSTVQCLKSVPELKSALSNYSLAARSNDVDQTSHMLTVATRELFGELDRSVNAVSPSQFWMVLRKKYPQFSQLQNGMHMQQDAEECWTQLLYTLSQSLKAPTSSEGADAVKALFGVNLQSRLHCQESGEESSETESVYSLKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTALYVKESLIDSLPRYLTVQFVRFFWKRESNQKAKILRKVDYPLVLDIFDLCSEDLRKKLEAPRQKLREEEGKKLGLQTSAKSGSKDSDVKMTDAEASANGSGESSTVNPQEGTSSEKETHMTGIYDLVAVLTHKGRSADSGHYVAWVKQESGKWIQYDDDNPSMQREEDITKLSGGGDWHMAYITMYKARFVSM Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquinated proteins mint ECF357E9C5BEF3F7 calm2_arath Calmodulin-2/3/5 CAM2 CAL1 At2g41110 T3K9.12 CAM3 At3g56800 T8M16.130 CAM5 TCH1 At2g27030 T20P8.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDGQINYEEFVKVMMAK 722B188A90AD423A ubp6-cam2 3 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q949Y0:p.Trp175Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W R This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing ' Wed May 02 19:52:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp175arg' Tue Jun 30 16:34:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp175Arg' binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1351085: original sequence: 169-202 : VSPSQFWMVLRKKYPQFSQLQNGMHMQQDAEEC Q949Y0:p.Leu178Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L K Wed May 02 18:59:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu178lys' Tue Jun 30 18:44:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu178Lys' Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction Interaction in presence of Ca2+ F2 F4 FEBS-Letters mint cam2-ubp6 4 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association NFA FEBS PAG 3886 mint cam2-ubp6-1 2 UBP6 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f3b mint cam2-ubp6-2 1 UBP6 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f3c mint