MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Proteolytic cleavage of ALF into alpha- and beta-subunits that form homologous and heterologous complexes with somatic TFIIA and TRF2 in male germ cells. Proteolytic cleavage of ALF into alpha- and beta-subunits that form homologous and heterologous complexes with somatic TFIIA and TRF2 in male germ cells. FEBS Lett. (0014-5793) 2005 imex curation Catena R., Argentini M., Martianov I., Parello C., Brancorsini S., Parvinen M., Sassone-Corsi P., Davidson I. no 2009-01-08 Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Catena R., Argentini M., Martianov I., Parello C., Brancorsini S., Parvinen M., Sassone-Corsi P., Davidson I. no FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation tf2aa_mouse Transcription initiation factor IIA subunit 1 Gtf2a1 General transcription factor IIA subunit 1 protein protein mouse Mus musculus Mouse MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHQHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLLQHMNASSITSAAATAATLALPAGVTPVQQLLTNSGQLLQVVRAANGAQYILQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPAPAQAPMPAAGQQQPQAQPAQQQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity mint FE28AA688662457E tf2ay_mouse TFIIA-alpha and beta-like factor Alf Gtf2a1lf Gtf2a1l General transcription factor II A, 1-like factor protein protein mouse Mus musculus Mouse MAFINLVPKLYQSVIEDVIEGVRDLFAEEGIEEQVLKDLKKLWETKVLQSKATEDFFRNSTQVPLLTLQLPHALPPALQPEASLLIPAGRTLPSFTPEDLNTANCGANFAFAGYPIHVPAGMAFQTASGHLYKVNVPVMVTQTSGRTEILQHPFQQVLQQLGQPLVIQTTVPTLHPCSLQAATEKSLRMEAVLQPPPILHPPPVDRTHVENAASDRRLLPGNELRPQESSPYLSLPGVGFPPQAALTESSLEPVLGVSASLTQNLHSDPFSQGPPGPLHHHLLESQLQSLKDSIYGCDSTKQLRKAEEPSSLRVSEKNCTSERDLNIRVTDDDINEIIQIDGTGDNSSTEEMGSIRDADENEFPGIIDAGDLNVLEEVDSVSNEDSTANSSDNEDHQINAPEEDPLNSGDDVSEQDVPDLFDTENVIVCQYDKIHRSKNRWKFYLKDGVMCFGGRDYVFAKAIGEAEW mint May function as a testis specific transcription factor. Binds DNA in conjunction with GTF2A2 and TBP (the TATA-binding protein) and together with GTF2A2, allows mRNA transcription EEE36B01A6B85B63 tbpl1_mouse TATA box-binding protein-like 1 Tbpl1 Tlp Tlp21 Tlf Trf2 Trp TATA box-binding protein-related factor 2 TBP-like factor TBP-related protein 21 kDa TBP-like protein protein protein mouse Mus musculus Mouse MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEIL Does not bind the TATA box. Has DNA-binding ability mint 2CDD9F5E7BDDE63F gtf2a1l-gtf2a1 1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 3 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1B The interaction occurs with both TFIIA alpha and beta isoforms FEBS-Letters mint gtf2a1l-gtf2a1l 1 3 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 3 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1B Interaction occurs between ALFalpha and ALF full lenght FEBS-Letters mint gtf2a1-tbpl1 1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1D FEBS-Letters mint gtf2a1l-gtf2a1l-1 1 3 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 3 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1C ALF beta interacts with both ALF full lenght and ALF alpha FEBS-Letters mint gtf2a1l-gtf2a1-2 1 2 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 3 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1C FEBS-Letters mint gtf2a1-gtf2a1 1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1E TFIIA beta (bait) interacts with TFIIA alpha (prey) FEBS-Letters mint gtf2a1-gtf2a1l 1 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 3 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1E FEBS-Letters mint