MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Co-expressed recombinant human Translin-Trax complex binds DNA. Co-expressed recombinant human Translin-Trax complex binds DNA. FEBS Lett. (0014-5793) 2005 imex curation Gupta GD., Makde RD., Kamdar RP., D'Souza JS., Kulkarni MG., Kumar V., Rao BJ. no 2009-01-08 Only protein-protein interactions in vitro In vitro experimental interac experimental interaction detection experimental interac nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gupta GD., Makde RD., Kamdar RP., D'Souza JS., Kulkarni MG., Kumar V., Rao BJ. no FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation tsnax_human Translin-associated protein X Translin-associated factor X TSNAX TRAX protein protein human Homo sapiens Human MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS D38B0DD96B50C0B9 DIP protein Q99598 original sequence version: 139 DIP protein Q99598 original sequence version: 93 The protein could not be merged with EBI-12908040 because of some conflicts with the protein sequence (features which cannot be shifted). D38B0DD96B50C0B9 tsn_human Translin TSN Component 3 of promoter of RISC protein protein human Homo sapiens Human MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGFQDIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDYLSGVLILASELSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKYDVKKVEEVVYDLSIRGFNKETAAACVEK DIP protein Q15631 original sequence version: 94 3CAAF20BED7C4939 tsnax-tsnax 1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 association association F1 FEBS-Letters homomint mint tsn-tsnax 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 association association F3 homomint mint