IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Isolation, subunit composition and interaction of the NDH-1 complexes from Thermosynechococcus elongatus BP-1. Isolation, subunit composition and interaction of the NDH-1 complexes from Thermosynechococcus elongatus BP-1. Biochem. J. (0264-6021) 2005 Zhang P., Battchikova N., Paakkarinen V., Katoh H., Iwai M., Ikeuchi M., Pakrasi HB., Ogawa T., Aro EM. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Four complexes were identified: NDH-1S (190 kDa), NDH-1M (300 kDa), NDH-1L (450 kDa) and NDH-1MS (490 kDa) which is composed of NDH-1S and NDH-1M. A complex between NdhD1 and NdhF1 was also identified. NDH-1S and NdhD1/NdhF1 complexes does not contain NdhL but NdhF1 has a polyhistidine motif. NDH-1 complexes were purified from solubilized thylakoids of a strain expressing His-NDH-L, a subunit of NDH-1. After pull-down, complexes components were identified by BN/SDS-PAGE gel and mass spectroscopy (MALDI-TOF or ESI MS/MS). Fig 3, Table 1, Table 2 evaaro@utu.fi synel Synechococcus elongatus comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel ms participant Identification by mass spectrometry ms participant Zhang P., Battchikova N., Paakkarinen V., Katoh H., Iwai M., Ikeuchi M., Pakrasi HB., Ogawa T., Aro EM. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Four complexes were identified: NDH-1S (190 kDa), NDH-1M (300 kDa), NDH-1L (450 kDa) and NDH-1MS (490 kDa) which is composed of NDH-1S and NDH-1M. A complex between NdhD1 and NdhF1 was also identified. NDH-1S and NdhD1/NdhF1 complexes does not contain NdhL but NdhF1 has a polyhistidine motif. NDH-1 complexes were purified from solubilized thylakoids of a strain expressing His-NDH-L, a subunit of NDH-1. After pull-down, complexes components were identified by BN/SDS-PAGE gel and mass spectroscopy (MALDI-TOF or ESI MS/MS). Fig 3, Table 1, Table 2 evaaro@utu.fi Biochem. J. (0264-6021) 2005 Isolation, subunit composition and interaction of the NDH-1 complexes from Thermosynechococcus elongatus BP-1. Isolation, subunit composition and interaction of the NDH-1 complexes from Thermosynechococcus elongatus BP-1. Biochem. J. (0264-6021) 2005 Zhang P., Battchikova N., Paakkarinen V., Katoh H., Iwai M., Ikeuchi M., Pakrasi HB., Ogawa T., Aro EM. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Four complexes were identified: NDH-1S (190 kDa), NDH-1M (300 kDa), NDH-1L (450 kDa) and NDH-1MS (490 kDa) which is composed of NDH-1S and NDH-1M. A complex between NdhD1 and NdhF1 was also identified. NDH-1S and NdhD1/NdhF1 complexes does not contain NdhL but NdhF1 has a polyhistidine motif. NDH-1 complexes were purified from solubilized thylakoids of a strain expressing His-NDH-L, a subunit of NDH-1. After pull-down, complexes components were identified by BN/SDS-PAGE gel and mass spectroscopy (MALDI-TOF or ESI MS/MS). Fig 3, Table 1, Table 2 evaaro@utu.fi synel Synechococcus elongatus comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel ms participant Identification by mass spectrometry ms participant Zhang P., Battchikova N., Paakkarinen V., Katoh H., Iwai M., Ikeuchi M., Pakrasi HB., Ogawa T., Aro EM. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Four complexes were identified: NDH-1S (190 kDa), NDH-1M (300 kDa), NDH-1L (450 kDa) and NDH-1MS (490 kDa) which is composed of NDH-1S and NDH-1M. A complex between NdhD1 and NdhF1 was also identified. NDH-1S and NdhD1/NdhF1 complexes does not contain NdhL but NdhF1 has a polyhistidine motif. NDH-1 complexes were purified from solubilized thylakoids of a strain expressing His-NDH-L, a subunit of NDH-1. After pull-down, complexes components were identified by BN/SDS-PAGE gel and mass spectroscopy (MALDI-TOF or ESI MS/MS). Fig 3, Table 1, Table 2 evaaro@utu.fi Biochem. J. (0264-6021) 2005 nu4c1_theeb NAD(P)H-quinone oxidoreductase chain 4 1 NAD(P)H dehydrogenase I, chain 4 1 NDH-1, chain 4 1 ndhD1 tll0719 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MSTFPWLTTIILFPIVAALAIPFIPDPTGKGRPIRWYALAVGLIDFALIVYAFTNFYDLNTPGMQLWESYDWIPEIGLRWSVGADGLSMPLILLTGFITTLAILAAWPVTLKPRLFYFLMLAMYGGQIAVFAVQDMLVFFLAWELELIPVYLLLAIWGGHKRQYAATKFILYTAGSSLFILVAGLAMAFYGDTVSFDMQTLAAKDYALGFQLLVYAGFLVAYGVKLPIVPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALIRMNVDMLPAAHAKFAPVLVILGVVNIIYAALTSYAQRNLKRKIAYSSISHIGFVLIGIASFTNLGMSGAVLQMVSHGLIGASLFFLVGATYDRTHTLILEEMGGVGQKMKKIFAMFTACSLASLALPGMSGFVAELMVFIGFATSDAYSLPFRVIVVFLAAVGVILTPIYLLSMLREIFYGPENKELVEHEALVDAEPREVFIIACLLVPIIGIGLYPKLLTQIYDATTGQVIARAREVLPTLAQQTEQPLGILPMVAPQLKANAQ D563D52DAAC8E11D ndhm_theeb NAD(P)H-quinone oxidoreductase subunit M tll0447 ndhM NAD(P)H dehydrogenase I subunit M protein protein theeb Thermosynechococcus elongatus (strain BP-1) MLLKSTTRHVHIYAGHVVDGEVHPDTETLTLNVDPDNELEWNEAALAKVEAKFRELVANAAGEDLTEYNLRRIGSDLEHFIRSLLMQGEIGYNLNSRVRNYSLGIPRVNHS AE906E9BE85CB0BE q8dkf5_theeb ndhF3 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MLQSFADTVWLIPFYSLAGMVLSLIWSPGITRKTGPRPAGYLNILLTFFSFVHALLATVAIANQPPQYLHWTWLDVAGLHLDIPVEISILTTTALMLITALNLMAQVFAVGYMEMDWGWARFFALLALFEGGMGALVLLDSLFFNYVVLEILTLATYLLIGLWFNQPLVVTGARDAFLTKRVGDLVLLMGVLAIYPLAGSWNYDDLAAWAATAQVNSTLITLICLALIAGPMGKCAQFPLHLWLDEAMEGPIPASILRNAVVVATGAWVLVKLTPVLSLSPVALTALLVIGSVTALGGTLIAIAQVDIKRALSYLVSAYMGWVFIAVGLKEPGLAFVFILTYSLAMAVLMMSIGSIIWNSVTQDLRLLGGLWSRRPISGISFLVGSAGLLAVPPLASFFPQAELLDTAFAQLPWVGGVLLLMNTFAAFSLGRTFCLVWGGEVKPMTARSPEVFWPMILPMTVDLGLVLHLPILMARFDWVIWTQPSLATAAALTITALLGWGVAAWVYLGKAIPKPVQFPLPSVQNLLAYDFYTPKLYRATVVGVVDMISRITAWFDRTFVDGTGNAFGVVTLLGGDRLKYSTTGQSQAYILTILMGIAILVIAICWPLLA 535C212E94C0AA17 nu3c_theeb NAD(P)H-quinone oxidoreductase subunit 3 ndhC tlr1429 NAD(P)H dehydrogenase subunit 3 NADH-plastoquinone oxidoreductase subunit 3 NDH-1 subunit 3 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MVAIPRLRDTATVFVLSGYEYFLGFLIICSLVPVLALAASALLRPKSGRMIRLTTYESGMEPIGGAWIQFNVRYYMFALVFVIFDVETVFLYPWAVAFHQLGLLAFIEALIFIAILVVALVYAWRKRALEWS DC2E8C8DDF6155B0 ndho_theeb NAD(P)H-quinone oxidoreductase subunit O tsl0017 ndhO NAD(P)H dehydrogenase I subunit O NDH-1 subunit O NDH-O protein protein theeb Thermosynechococcus elongatus (strain BP-1) MAIKKGDLVKVVAEKLANSLEALASDHRYPPYLFEGRGEVVDIRGDYAQIKFPVPTPTVWLRLDQLEVAQ DAFCC54E4A56DBDC q8dkf3_theeb tlr0906 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MVQAMERPSSAKLPPLDHPLADIIYRLEAGGALIPDTPVNLMKIIGMYKAYSIPMDFYWRDLLYLGERVFINPFPFFKYFPTKEYFELPNHYAGDTADLRIWRGPAHAHPELMEFIEKGETGKMPRLLHHLWHDRINMEFSEDLARAMMWHRMGGQLDIYLDSEEYKAAADKAIRAYFKRNPLMLGLYKLFPDLFLEQARQATYMNVLGLFWEVMAPVFFEISDRYDEGSITSVKDAMNFLVNGIFAIAGRPIYHHVYIDDEVHVLVPKEKGFMWLYEAAFPYVEAVFYRTSPFRGTKSYNAQANQVPTDQVDFHYGILFADKFPVGTAGIPPTLLHQDMYHFLPQYLKDYFHQHCRGEDDILVQLGIAFQHAMYTVTSAVLQATRAAFYYPLDDPNPEHLMANRRFFVAQMDRFLRPQYGIAEACKIRNVQDPNYL 213F25F566D7D178 ndhn_theeb NAD(P)H-quinone oxidoreductase subunit N tlr1130 ndhN NAD(P)H dehydrogenase I subunit N protein protein theeb Thermosynechococcus elongatus (strain BP-1) MGLLAGYQFVKDLESAGALALFVPPEGGFEGRYQRRLRSKGYTTLPMSAPGLGDLAAYLTQEHGIRPAHTGKEDIRVYFQPPLVTYHLENLPPNAKGLVLWLIDGKRLSKQEFAYLAQLTQTLPKFKVVVEVGGDRVVRWEPLADWVAAA 6ED2F8EE6E024909 nu2c_theeb NAD(P)H-quinone oxidoreductase subunit 2 NAD(P)H dehydrogenase subunit 2 NADH-plastoquinone oxidoreductase subunit 2 ndhB tll0045 NDH-1, subunit 2 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MDLVTLAGQLNAGTILPETILIVTLLVVLLADLIQGRQADRWTPYFAIVGLGGAIATMIPLWTQPATISFFGSFISDHLSLFFRGLIALSALGTILMSIRYVEQTGSSLGEFMTILLTATVGGMFIAGAQELVFIFVALETLSIASYLLTGYTKRDSRSNEAALKYLLIGAASSAIFLYGSSLLYGLSGGHTQLPAIAQALSSESLGLVVALVFVIAGISFKISAVPFHQWTPDVYEGAPTPVVAFLSVGSKAAGFALAIRFLTLAFPSVTDQWQLIFTVLAILSMILGNVVALAQTSMKRMLAYSSIGQAGFVMIGFVVGTEAGYASMLFYLLVYLFMNLGAFTCVILFSLRTGTDQISEYAGLYQKDPLLTLGLSLCLLSLGGIPPLAGFFGKIYLFWAGWQAGAYGLVLLGLLTSVISIYYYIRVVKMMVVKEPQEMSEAVRNYPEVSWSSFGLRPLQVGLVMTVIATSLAGILANPLFNLVNTAVWDVPQLANQPTVMEVAYQALSPAGKS 24669A026C5620E8 ndhj_theeb NAD(P)H-quinone oxidoreductase subunit J NAD(P)H dehydrogenase subunit J NADH-plastoquinone oxidoreductase subunit J NDH-1 subunit J ndhJ tlr1430 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MSDTPEAPIVEAGPVGRLLQSQNLSVESLGRDASGVEMIKVDRDRLLAVCQTLYADGFNYLRCQAAYDSGPGQDLVSTYHLIKLSDNADRPPEVRIKVFVPRDDPRVPSVYWIWKTADWQERESYDMFGIVYEGHPNLKRILMPEDWVGWPLRKDYITPDFYELQEAY 618C5809ABE6312C q8dma1_theeb tll0220 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MATIVDIAVNTPGFSTLVTAVKVANLVEALQSPGPFTVFAPNDDAFAKLPDGTITSLVQNPPQLGRILKYHVVAGAYKATDLKRMGIVTSLEGSTIPIHGDNPLEVKNATVLAADIEAENGIIHVIDTVILMGLDPAHSFQETNIPYKV D70A79B8AE5E1C0A q8dkf4_theeb ndhD3 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MLHSLRFLPMLTLLIVLPVIGALLMPLLPERVLRSVALVIAGLTFALSLWMLTQFDVHQSALQFTEFVPWLLPLGLNYSLGVDGLSLPLIVLGTFLTLGVVFTGEKTGQRLFYALVLLANAGITGALAAQNLLLFFLFYELELVPFYLLILIWGGQRREQAAVKFLIYTAVSGILVLAAFLAMGWLTHAPSFDSADIQIAGLAPTTQGILLLLLILGFGIKMPLVPLHSWLPDAYVEASTPTAILLGGALAKLGAYGLVRFALGYFPEAWAQFSGLLAIVAAVGIAYGALAAIAQKDIKRMVAYSSIGHMSYVLLAAAAHTHLSMVGAIAQMISHGLILALLFYLVGVIETKVGTRELNVLNGLLNPLRGLPTTSALLILGGMASAGIPGLVGFVAEFLIFQGSYGMFPLPTLVAVVGTGLTAVYFVIMINRTCFGRLDNRTAYYPRVVWSEKMPALVLTLLIVFLGVQPTWLVRWSETTSAQIVAAVPRTNELVATLAKR 50B92C9B5C247185 ndhk_theeb NAD(P)H-quinone oxidoreductase subunit K NAD(P)H dehydrogenase I subunit K NDH-1 subunit K ndhK tlr0705 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MTNTTSPAILNPIARPEVPQELAENIILTSLNDVYDWARLSSLWPLMYGTACCFIEFAAMIGSRFDFDRFGLVPRNSPRQADLIITSGTITMKMAPALVRLYEQMPSPKYVIAMGACTITGGMFSSDSYSAVRGVDKLIPVDVYLPGCPPRPEAIMDAIVKLRKKIANEHINERGNLAQTHRLFTAKHKMKPVPPILTGQYLNAPSRQAPPPALAAAMGIAVPALGEAVSETTSVAE F25839B9F65C06CE ndhl_theeb NAD(P)H-quinone oxidoreductase subunit L ndhL tsr0706 NAD(P)H dehydrogenase I subunit L NDH-1 subunit L NDH-L protein protein theeb Thermosynechococcus elongatus (strain BP-1) MAVSTELLVLGVYGALAGLYLLVVPAIVYAYLNARWYVASSFERAFMYFLVTFFFPGLLLLAPFINFRPQPRSLNS 3FAA4D52E0CE3D25 ndhh_theeb NAD(P)H-quinone oxidoreductase subunit H NAD(P)H dehydrogenase subunit H NADH-plastoquinone oxidoreductase subunit H NDH-1 subunit H ndhH tlr1288 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MPKIETRTEPMVINMGPHHPSMHGVLRLMVTLDGEDVIDCEPVIGYLHRGMEKIAENRTNIMFIPYVSRWDYAAGMFNEAVTVNAPEKLAGIPVPKRASYIRVIMLELNRIANHLLWLGPFLADVGAQTPFFYIFREREYIYDLFEAATGMRFINNNYFRIGGVAADLTYGWVTKCRDFCDYFLPKVDEYERLITNNPIFVRRLQGVGKISREEAINWGLSGPMLRASGVKWDLRKVDHYECYDDFDWDVPVATEGDCLARYIVRIQEMRESVKIIRQALDGLPGGPYENLEAKRMLEGAKSEWNGFDYQYIGKKLSPTFKIPKGEHYVRVESGKGELGIYLIGDDNVFPWRWKIRPPDFNNLQVLPQLLKGMKVADIVAILGSIDVIMGSVDR 8E27898D7A82A965 q8dl29_theeb NAD(P)H-quinone oxidoreductase subunit 4L ndhE NAD(P)H dehydrogenase subunit 4L NADH-plastoquinone oxidoreductase subunit 4L NDH-1, subunit 4L NDH-E protein protein theeb Thermosynechococcus elongatus (strain BP-1) MQLTYVLILAALLFCIGIYGLVTSRNAVRVLMSIELLLNAVNLNLIGFANYLDGQQIKGQVFAVFVITVAAAEAAVGLAIILAIYRNRDTVDMEKFNLLKW 8C2C455D4A7C9BA1 ndhi_theeb NAD(P)H-quinone oxidoreductase subunit I NAD(P)H dehydrogenase I subunit I NDH-1 subunit I ndhI tlr0668 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MKFLNQITNYAKEAVQSAKYIGQGLSVTFDHMRRRPITVQYPYEKLIPSERFRGRIHFEFDKCIACEVCVRVCPINLPVVDWVFNKELKKKELKHYSIDFGVCIFCANCVEYCPTNCLSVTEEYELATYDRHELNYDSVAMGRIPYKVTQDPMVTPIREFAYLPAGVMSGHDLPAGAQRAGERPEAIANTAKSSEN C0E4ED55F3DFC670 nu1c_theeb NAD(P)H-quinone oxidoreductase subunit 1 NAD(P)H dehydrogenase I subunit 1 NDH-1 subunit 1 NDH-A ndhA tlr0667 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MESGIDLQGQFISALQSLGLSHDLAKLLWLPLPMLMMLIVATVGVLVAVWLERKISAAVQQRIGPEYIGPLGILAPLADGLKLIFKEDVLPANSDRWLFTLGPAVVVIPVFLSYIIVPFGQNLLISNLAMGVFLWIALSSIAPIGLLMAGYASNNKYSLLGGLRAAAQSISYEIPLALAVLAVAMMSNGLGTVEIVEQQSQYGILSWNVWRQPIGFLVFWIAALAECERLPFDLPEAEEELVAGYQTEYAGMKFALFYLGAYVNLVLSALLVSVLYFGGWSFPIPLETIANLLGVSETNPFLQIAFAVLGITMTLIKAYFFVFLAILLRWTVPRVRIDQLLDLGWKFLLPVGLVNLLLTAGLKLAFPVAFGG D4B1D0A297170A66 q8dkx9_theeb ndhF1 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MEPLYQYAWLIPVLPLLGALIVGFGLIAFSETTSKLRRPSAIFIMALMAIAMGHSLTLFWSQVQGHLPYTQMIEWAAAGNLHIAMGYVIDPLAALMLVIVTTVAFLVMLYSDGYMAHDPGYVRFFAYLSLFGSSMLGLVVSPNLVQVYIFWELVGMCSYLLIGFWYDRKSAAEAAQKAFVTNRVGDFGLLLGMVGLFWATGTFDFAGMGDRLTELVNTGLLSPSLAAILAILVFLGPVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGVFLIARMFPVFEQLPQVMTTIAWTGAFTAFMGATIAITQNDIKKSLAYSTISQLGYMVMGMGVGAYSAGLFHLMTHAYFKAMLFLGSGSVIHSMEGVVGHNPDLAQDMRYMGGLRKYMPITGATFLVGCLAISGVPPFAGFWSKDEILGAVFHANPAMWLLTWLTAGLTAFYMFRMYFMTFEGKFRNVPPERQEHHDHHSHHAAVPHESPWTMTLPLVVLAIPSTLIGFVGTPFNNLFEVFIHAPGEEKVAEHAVDLTEFLILGGSSVGIGLMGITVAYLMYLKGTPSPQAIAKAIQPLYQFSLHKWYFDELYEAVFIKGCRRLARQVLEVDYNVVDGVVNLTGFVTMVTGEGLKYLQNGRAQFYALIVLLAVLGFVIFSVQT 2E30964AB47BDC05 ndhd3-ndhf3-1 2 5 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component physical association physical association NDH-1S: 190 kDa low CO2 (air level) high CO2 (4.5%) The complex may have been purified throught the polyhistidine motif found in NdhF1. ndhf1-ndhd1 2 20 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component physical association physical association The complex may have been purified throught the polyhistidine motif found in NdhF1. ndhi-ndhj-2 2 14 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component physical association physical association NDH-1M: 300 kDa The NDH-1M contains same 13 ndh gene products as NDH-1L but lacked the NdhD1 and NdhF1 subunits. NDH-1M complex is formed by hydrophylic components (NdhH, I, J, K, M, N and O) and the membrane proteins (NdhA, B, C, E, G amd L) ndhi-ndhj-3 2 3 unspecified role unspecified role neutral component neutral component 20 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component physical association physical association NDH-1M: 450 kDa The NDH-1L contains 15 ndh gene products from which 13 are found in as NDH-1M lacking the NdhD1 and NdhF1 subunits. NDH-1M complex is formed by hydrophylic components (NdhH, I, J, K, M, N and O) and the membrane proteins (NDHA, B, C, D1, E, F1, G and L) ndhi-ndhj-4 2 13 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component physical association physical association NDH-1MS: 490kDa NDH-1MS is composed of NDH-1M complex and NDH-1S complex high CO2 (4.5%) low CO2 (air level) NDH-1MS is fragile for purification and dissociates into NDH-1M and NDH-1S if the concentration of detergent is high. (more complex found if beta-DM < 0.25 %) ndhi-ndhj-5 1 10 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component 20 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component physical association physical association NDH-1M: 450 kDa The NDH-1L contains 15 ndh gene products from which 13 are found in as NDH-1M lacking the NdhD1 and NdhF1 subunits. NDH-1M complex is formed by hydrophylic components (NdhH, I, J, K, M, N and O) and the membrane proteins (NDHA, B, C, D1, E, F1, G and L) The complex may have been purified through the histidine motif found in NdhF1. ndhd3-ndhf3-2 1 13 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component physical association physical association NDH-1S: 190 kDa low CO2 (air level) high CO2 (4.5%) ndhf1-ndhd1-1 1 20 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component physical association physical association The complex may have been purified throught the histidine motif found in NdhF1. ndhi-ndhj-6 1 11 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component physical association physical association NDH-1M: 300 kDa The NDH-1M contains same 13 ndh gene products as NDH-1L but lacked the NdhD1 and NdhF1 subunits. NDH-1M complex is formed by hydrophylic components (NdhH, I, J, K, M, N and O) and the membrane proteins (NdhA, B, C, E, G amd L) The NDH-1M may be purified as a supercomplex NDH-1MS containing cupA. This supercomplex, fragilized by the his tag of cupA, dissociates during the experiment into NDH-1M and NDH-1S.