IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Gamma carbonic anhydrase like complex interact with plant mitochondrial complex I. Gamma carbonic anhydrase like complex interact with plant mitochondrial complex I. Plant Mol. Biol. (0167-4412) 2004 Perales M., Parisi G., Fornasari MS., Colaneri A., Villarreal F., Gonzalez-Schain N., Echave J., Gomez-Casati D., Braun HP., Araya A., Zabaleta E. An arabidopsis flower cDNA lbrary was used in this study. Figure 1. ezabalet@mdp.edu.ar yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Perales M., Parisi G., Fornasari MS., Colaneri A., Villarreal F., Gonzalez-Schain N., Echave J., Gomez-Casati D., Braun HP., Araya A., Zabaleta E. An arabidopsis flower cDNA lbrary was used in this study. Figure 1. ezabalet@mdp.edu.ar Annotation to indicate that this entry has been checked and accepted by a senior curator. Annotation to indicate that this entry has been checked and accepted by a senior curator. Plant Mol. Biol. (0167-4412) 2004 Gamma carbonic anhydrase like complex interact with plant mitochondrial complex I. Gamma carbonic anhydrase like complex interact with plant mitochondrial complex I. Plant Mol. Biol. (0167-4412) 2004 Perales M., Parisi G., Fornasari MS., Colaneri A., Villarreal F., Gonzalez-Schain N., Echave J., Gomez-Casati D., Braun HP., Araya A., Zabaleta E. An arabidopsis flower cDNA lbrary was used in this study. Figure 1. ezabalet@mdp.edu.ar yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Perales M., Parisi G., Fornasari MS., Colaneri A., Villarreal F., Gonzalez-Schain N., Echave J., Gomez-Casati D., Braun HP., Araya A., Zabaleta E. An arabidopsis flower cDNA lbrary was used in this study. Figure 1. ezabalet@mdp.edu.ar Annotation to indicate that this entry has been checked and accepted by a senior curator. Annotation to indicate that this entry has been checked and accepted by a senior curator. Plant Mol. Biol. (0167-4412) 2004 o65496_arath At4g35320 F23E12.120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress METLQIRKPTSLPVSQRPNAAATADDEPGLIRRRLSSLSLNLSNQPAAIAARFPRSKSVSAMGEQAGSSVKEWWEWGWSWILSRKPIFIRDLELNKDEAKSIGSQNRGSIMHVFFKLRSQIRNFMGPSSEDSLPLSCKYKRQR 4EDC66FEEFA24477 gcal2_arath Gamma carbonic anhydrase-like 2, mitochondrial GAMMACAL2 T8P19.190 At3g48680 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATSLARISKRSITSAVSSNLIRRYFAAEAVAVATTETPKPKSQVTPSPDRVKWDYRGQRQIIPLGQWLPKVAVDAYVAPNVVLAGQVTVWDGSSVWNGAVLRGDLNKITVGFCSNVQERCVVHAAWSSPTGLPAQTLIDRYVTVGAYSLLRSCTIEPECIIGQHSILMEGSLVETRSILEAGSVLPPGRRIPSGELWGGNPARFIRTLTNEETLEIPKLAVAINHLSGDYFSEFLPYSTIYLEVEKFKKSLGIAI 3AFB1905F4EEA2D1 gcal1_arath Gamma carbonic anhydrase-like 1, mitochondrial GAMMACAL1 MLE2.14 At5g63510 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATSIARLSRRGVTSNLIRRCFAAEAALARKTELPKPQFTVSPSTDRVKWDYRGQRQIIPLGQWLPKVAVDAYVAPNVVLAGQVTVWDGSSVWNGAVLRGDLNKITVGFCSNVQERCVVHAAWSSPTGLPAATIIDRYVTVGAYSLLRSCTIEPECIIGQHSILMEGSLVETRSILEAGSVVPPGRRIPSGELWGGNPARFIRTLTNEETLEIPKLAVAINHLSGDYFSEFLPYSTVYLEVEKFKKSLGIAV B718E71B22ACC4A7 gca2_arath Gamma carbonic anhydrase 2, mitochondrial GAMMACA2 APFI Transcription factor APFI F8G22.2 At1g47260 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVFVAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPTLIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGEVWGGNPAKFMRKLTDEEIVYISQSAKNYINLAQIHASENSKSFEQIEVERALRKKYARKDEDYDSMLGITRETPPELILPDNVLPGGKPVAKVPSTQYF 15396A4C3D61F731 gca1_arath Gamma carbonic anhydrase 1, mitochondrial GAMMACA1 F14P1.8 F18O14.34 At1g19580 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAFVAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVIEFEKVLRKKHALKDEEYDSMLGIVRETPPELNLPNNILPDKETKRPSNVN 7F3D6AF91DB1B8D8 at1g47260-f23e12_120 1 6 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association at1g47260-at5g63510 1 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association at1g47260-at3g48680 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association at1g47260-at1g19580 2 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association at1g47260-at1g47260 2 6 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association