IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Arabidopsis has two redundant Cullin3 proteins that are essential for embryo development and that interact with RBX1 and BTB proteins to form multisubunit E3 ubiquitin ligase complexes in vivo. Arabidopsis has two redundant Cullin3 proteins that are essential for embryo development and that interact with RBX1 and BTB proteins to form multisubunit E3 ubiquitin ligase complexes in vivo. Plant Cell (1040-4651) 2005 Figueroa P., Gusmaroli G., Serino G., Habashi J., Ma L., Shen Y., Feng S., Bostick M., Callis J., Hellmann H., Deng XW. revisit when protein editor in place: paper contains data using anti-Cul3 and anti-RBX antibodies that could be entered later. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Figueroa P., Gusmaroli G., Serino G., Habashi J., Ma L., Shen Y., Feng S., Bostick M., Callis J., Hellmann H., Deng XW. revisit when protein editor in place: paper contains data using anti-Cul3 and anti-RBX antibodies that could be entered later. Directed yeast two hybrid assay Plant Cell (1040-4651) 2005 Arabidopsis has two redundant Cullin3 proteins that are essential for embryo development and that interact with RBX1 and BTB proteins to form multisubunit E3 ubiquitin ligase complexes in vivo. Arabidopsis has two redundant Cullin3 proteins that are essential for embryo development and that interact with RBX1 and BTB proteins to form multisubunit E3 ubiquitin ligase complexes in vivo. Plant Cell (1040-4651) 2005 Figueroa P., Gusmaroli G., Serino G., Habashi J., Ma L., Shen Y., Feng S., Bostick M., Callis J., Hellmann H., Deng XW. revisit when protein editor in place: paper contains data using anti-Cul3 and anti-RBX antibodies that could be entered later. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Figueroa P., Gusmaroli G., Serino G., Habashi J., Ma L., Shen Y., Feng S., Bostick M., Callis J., Hellmann H., Deng XW. revisit when protein editor in place: paper contains data using anti-Cul3 and anti-RBX antibodies that could be entered later. Plant Cell (1040-4651) 2005 cul3a_arath Cullin-3A CUL3A T2P11.2 CUL3 At1g26830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNQKKRNFQIEAFKHRVVVDPKYADKTWQILERAIHQIYNQDASGLSFEELYRNAYNMVLHKFGEKLYTGFIATMTSHLKEKSKLIEAAQGGSFLEELNKKWNEHNKALEMIRDILMYMDRTYIESTKKTHVHPMGLNLWRDNVVHFTKIHTRLLNTLLDLVQKERIGEVIDRGLMRNVIKMFMDLGESVYQEDFEKPFLDASSEFYKVESQEFIESCDCGDYLKKSEKRLTEEIERVAHYLDAKSEEKITSVVEKEMIANHMQRLVHMENSGLVNMLLNDKYEDLGRMYNLFRRVTNGLVTVRDVMTSHLREMGKQLVTDPEKSKDPVEFVQRLLDERDKYDKIINTAFGNDKTFQNALNSSFEYFINLNARSPEFISLFVDDKLRKGLKGITDVDVEVILDKVMMLFRYLQEKDVFEKYYKQHLAKRLLSGKTVSDDAERSLIVKLKTECGYQFTSKLEGMFTDMKTSEDTMRGFYGSHPELSEGPTLIVQVLTTGSWPTQPAVPCNLPAEVSVLCEKFRSYYLGTHTGRRLSWQTNMGTADIKAIFGKGQKHELNVSTFQMCVLMLFNNSDRLSYKEIEQATEIPAADLKRCLQSLACVKGKNVIKKEPMSKDIGEEDLFVVNDKFTSKFYKVKIGTVVAQKETEPEKQETRQRVEEDRKPQIEAAIVRIMKSRKILDHNNIIAEVTKQLQPRFLANPTEIKKRIESLIERDFLERDSTDRKLYRYLA DIP protein Q9ZVH4 original sequence version: 81 40F58A46BB5572ED bt3_arath BTB/POZ and TAZ domain-containing protein 3 BT3 F3F20.14 At1g05690 BTB and TAZ domain protein 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSTKNIPKPPPLPCITYQRFQSSTRKPSSLMRLVPKEALETWDKLFKEGSGADTYVETDNKSHFPAHSSVLAAASPVIATLLNQSRDKNGNTYLKIHGVPCEAVYMFIRFLYSSCYEEEEMKKFVLHLLVLSHCYSVPSLKRLCVEILDQGWINKENVIDVLQLARNCDVTRICFVCLSMVIKDFKSVSSTEGWKVMKRSNPLLEQELIEAVIESDSRKQERRRKLEEREVYLQLYEAMEALVHICREGCGTIGPRDKALKGSHTVCKFPACKGLEGALRHFLGCKSRASCSHCKRMWQLLQLHSCICDDSNSCKVSLCWNFKEKMKKLSKKEQSKWRLLVENIIRARNSLGPFSSRSSGLI 7011FA737154DF34 y1164_arath BTB/POZ domain-containing protein At1g01640 At1g01640 T1N6.2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTEAEQKAAFLGGLVVSFKEQMHTDVLVKPGEEAPPIPTHKAVLAARSKVFRNMLDSDECKTSPEESITLPDLSHDELKSLLEFLYSGNLKAPYNQYRSLYLAADKYDISYLQDVCRNHFIASLSSRNVLDILELASIPCDTILKDAAINHIVKHMEEVVVPMKYETFVQRNPDLSVEITRAYLRETKAKAKDHGAPLNGNTRPRIW A108E941AE9221F0 y1178_arath BTB/POZ domain-containing protein At1g21780 At1g21780 F8K7.22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGDTKVETISRLAQWRIENFGPCSFKKSDPFKVGIWNWHLSIERNRYLSVRLFPELSRVSKEQPPVAKFVLRVSNVGPNRRFYISPVYEKLLRTTDDCVWHVDSSFHGRFTIDVEFLDLKICPVNGGEASPVWPTDATMQSISTQTTLKCLSRMLEESILTDVIIHTADGTLSAHKAILSASSTVFKSMFHHDLMEKESSTIHIDDMSRESCMALLSYLYGNITQEEFWKHRLALLGAANKYDITDLKAACEESLMEDINSSNVLERLQEAWLYQLEKLKKGCLMYLFDFGKIYDVREEISSFFRQADRELMLEMFQEVLSVWKPV 34E3DB7AB972B25E y5851_arath BTB/POZ domain-containing protein At5g48510 At5g48510 MJE7.15 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATPTNKEHFSGGLAKVLAEKWQVDVMLKAKNSDEGSAISAHKLILASRSEVFKNMFELDEFKTSTKHVETITLSEMKHEELEAFVEFICSDGSMLSANVKQHARSLYLAADKYEILHLRDLCRTELISSLSLLNSLDLLVLAQIPFDKVLNDESFSYIKNNISTIASSDEFKLFVAGNPNLAVEIMKVSLITLTLRCSSCGSNHSLQGMYCCNCCRYGTLRLI 48EF185120B26D29 bt5_arath BTB/POZ and TAZ domain-containing protein 5 BT5 BTB and TAZ domain protein 5 F19F18.100 At4g37610 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MENMDDFSPENVLAPPPPPPPMKKSTDLFMQRSNSFVSKATRDSWDRMFDEAHGADVLIHTDDNGLIYAHSNVIGMASDVIRGMMKQHKRKSHRKSISILGVPHHALRVFIRFLYSSCYEKQDMEDFAIHLLVLSHVYVVPHLKRVCESEFESSLLNKENVIDVFQLALLCDAPRLGLLCHRMILNNFEEVSTSEGWQAMKESHPRLQKELLRSVAYELNSLKQRNRKQKEIQTYTQLYEAMEAFVHICRDGCREIGPTKTETPHMSCGFQACNGLEQLLKHLAGCKLRSIPGGCSRCKRMWQLLELHSRICVDSEQCKVPLCSSLKERMKTQSRKDEKRWKLLVRNVLSTKRIGGSPFFLQAIDVTL CB531228DAB7212B bpm6_arath BTB/POZ and MATH domain-containing protein 6 BPM6 Protein BTB-POZ AND MATH DOMAIN 6 F23N14_80 At3g43700 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKLMTRTSGSSSPNTIPDQIESPTSSRSVTQTTNGSHQFVIQGYSLAKGIGVGKHIASDNFSVGGYQWTIFVYPDGKNPEDNSSYVSVFIVLASECTEVRALFELSLVDQSGKGKHKVHSHFNRSLDGGPYTLKYRGSMWGYKRFFRRSLLETSDYLKDDCLKINCTVGVVVSEMHCPRLLSIHVPDSELGSHFGKLLDTLQGSDVTFDVAGEKFQAHKLVLAARSQFFRSMFYNTLAENNSDVVISDLEPKVFKALLHFMYKDSLPGDVEPLTAHSFDLLRPSEIDDTLIVKLLAAAEMYNLSRLRLLCESHICKGISISSVSKILALSDKYNASELKSVSLKFTAENLAAVLQTKAYEDLKDDCPNLQSELLKAVAGYDDTSSSGGGKSQSVWAQLSNGGETSSRRVRQRTT AF911274AC17794D bt1_arath BTB/POZ and TAZ domain-containing protein 1 At5g63160 BT1 BTB and TAZ domain protein 1 MDC12.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAITATQNDGVSLNANKISYDLVETDVEIITSGRRSIPAHSGILASVSPVLTNIIEKPRKIHGGSSKKVIKILGVPCDAVSVFVRFLYSPSVTENEMEKYGIHLLALSHVYMVTQLKQRCTKGVGERVTAENVVDILQLARLCDAPDLCLKCMRFIHYKFKTVEQTEGWKFLQEHDPFLELDILQFIDDAESRKKRRRRHRREQNLYLQLSEAMECIEHICTEGCTLVGPSSNLDNKSTCQAKPGPCSAFSTCYGLQLLIRHFAVCKKRVDGKGCVRCKRMIQLLRLHSSICDQSESCRVPLCRQYKNRGEKDKKMVEDTKWKVLVRRVASAKAMSSLSQSKKKKSEVLFKEEAEDLIRIRNKLM 53142FB681946BE5 bpm3_arath BTB/POZ and MATH domain-containing protein 3 At2g39760 BPM3 Protein BTB-POZ AND MATH DOMAIN 3 T5I7.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTVGGIEQLIPDSVSTSFIETVNGSHQFTIQGYSLAKGMSPGKFIQSDIFSVGGYDWAIYFYPDGKNPEDQSSYISLFIALASDSNDIRALFELTLMDQSGKGKHKVHSHFDRALEGGPYTLKYKGSMWGYKRFFKRSALETSDYLKDDCLVINCTVGVVRARLEGPKQYGIVLPLSNMGQGLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFFGPIGNNNVDRIVIDDIEPSIFKAMLSFIYTDVLPNVHEITGSTSASSFTNMIQHLLAAADLYDLARLKILCEVLLCEKLDVDNVATTLALAEQHQFLQLKAFCLEFVASPANLGAVMKSEGFKHLKQSCPTLLSELLNTVAAADKSSTSGQSNKKRSASSVLGCDTTNVRQLRRRTRKEVRAVS 31B93225F439926B bpm1_arath BTB/POZ and MATH domain-containing protein 1 At5g19000 BPM1 Protein BTB-POZ AND MATH DOMAIN 1 T16G12.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGTTRVCSEVSSGSSKSLSQSLTVSTSTTETVNGFHEFKICGYSLAKGVGVGKYVASDTFMVGGYSWAIYFYPDGKSPEDNSSYVSLFIALASEGADVRALFELTLVDQSGNGKHKVHSHFGRALDSGPYTLKYRGSMWGYKRFFRRSSLESSDYLKENSLLVRCRVGVVKSVTEGPRYYNIPVPVSNLGQQLGNLLESGKGCDVVFQVDGETFNAHKLVLATRSPVFNAQLFGPLGDRNTKCITIEDMEAPIFKVLLHFIYWDELPDMQELIGTDSTLASTLVAQHLLAAADRYALERLKAICESKLCEGVAINTVATTLALAEQHHCLQLKAVCLKFVALPENLKAVMQTDGFDYLKESCPSLLTELLQYVARLSEHSVIVSGHRKEIFADGCDASGRRVKPRLH 863D1AFF7068CD66 bpm2_arath BTB/POZ and MATH domain-containing protein 2 F28L1.13 At3g06190 BPM2 Protein BTB-POZ AND MATH DOMAIN 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTIRVSKEVPGSSKSTAQSLTESTSRTETINGSHEFKISGYSLVKGMGIGKYVASDTFMVGGYSWAIYFYPDGKSPEDNSVYVSLFIALASEGADVRALFELTLVDQSGNERHKVHSHFGRTLESGPYTLKYRGSMWGYKRFFKRSLLESSDYLKDNGLLVRCCVGVVKSRTEGPRCYNIPVPVSGLGQQFGKLLESGKGADVTFEVDGETFPAHKLVLAARSAVFRAQLFGPLRSENTNCIIIEDVQAPIFKMLLHFIYWDEMPDMQDLIGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCEGISINTVATTLALAEQHHCFQLKAACLKFIALPENLKAVMETDGFDYLKESCPSLLSELLEYVARLSEHSLTSSGHRKELFADGCDLNGRRVKQRLH D33F6BEB990262EC bt2_arath BTB/POZ and TAZ domain-containing protein 2 BT2 At3g48360 BTB and TAZ domain protein 2 T29H11.120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEAVLVAMSVPATTEDDGFSLITDKLSYNLTPTSDVEIVTSDNRRIPAHSGVLASASPVLMNIMKKPMRRYRGCGSKRVIKILGVPCDAVSVFIKFLYSSSLTEDEMERYGIHLLALSHVYMVTQLKQRCSKGVVQRLTTENVVDVLQLARLCDAPDVCLRSMRLIHSQFKTVEQTEGWKFIQEHDPFLELDILQFIDDAESRKKRRRRHRKEQDLYMQLSEAMECIEHICTQGCTLVGPSNVVDNNKKSMTAEKSEPCKAFSTCYGLQLLIRHFAVCKRRNNDKGCLRCKRMLQLFRLHSLICDQPDSCRVPLCRQFRKRGEQDKKMGEDTKWKLLVTRVVSAKAMTSLCQSKKNKCEQAQGV 59235A953EC36CD6 cul3a-q9xhz8 2 6 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role bait bait n-terminal maltose binding protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association cul3a-q8l765 2 3 unspecified role unspecified role bait bait n-terminal maltose binding protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 12 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association cul3a-q9m8j9 2 13 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role bait bait n-terminal maltose binding protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association cul3a-o22286 2 11 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait n-terminal maltose binding protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association cul3a-q9szf4 2 3 unspecified role unspecified role bait bait n-terminal maltose binding protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 8 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association cul3a-q9lq95 2 5 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait n-terminal maltose binding protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association cul3a-q9lv63 2 3 unspecified role unspecified role bait bait n-terminal maltose binding protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association cul3a-q94bn0 2 3 unspecified role unspecified role bait bait n-terminal maltose binding protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 14 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association cul3a-q9fmk7 2 10 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait n-terminal maltose binding protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association cul3a-q9m2b6 2 9 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait n-terminal maltose binding protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association cul3a-q9sly0 2 4 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait n-terminal maltose binding protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association q9xhz8-q9xhz8 1 6 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association cul3a-q9xhz8-1 1 3 unspecified role unspecified role bait bait Q9ZVH4:p.Ser48Ala Serine 48 Alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:28:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser48ala' Tue Jun 30 17:54:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser48Ala' Q9ZVH4:p.Phe49Ala Phenylalanine 49 Alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A Wed May 02 15:00:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe49ala' Tue Jun 30 17:53:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe49Ala' 6 unspecified role unspecified role prey prey Q9XHZ8:p.Tyr242Ala Tyrosine 242 alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Fri Jul 22 10:55:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'try242ala' Wed May 02 16:41:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr242ala' Tue Jun 30 20:09:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr242Ala' Q9XHZ8:p.Ile204Arg Isoleucine 204 arginine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I R Wed May 02 19:43:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile204arg' Tue Jun 30 19:27:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile204Arg' physical association physical association cul3a-q9xhz8-2 2 3 unspecified role unspecified role bait bait n-terminal maltose binding protein tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region BTB domain and N terminal flanking region involved in binding to Cul3a protein binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association