IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of NIMIN1 with NPR1 modulates PR gene expression in Arabidopsis. Interaction of NIMIN1 with NPR1 modulates PR gene expression in Arabidopsis. Plant Cell (1040-4651) 2005 Weigel RR., Pfitzner UM., Gatz C. In this study transgenic plants expressing the tagged proteins were crossed and anti-tag coimmunoprecipitation assay undertaken. rweigel@gwdg.de arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Weigel RR., Pfitzner UM., Gatz C. In this study transgenic plants expressing the tagged proteins were crossed and anti-tag coimmunoprecipitation assay undertaken. In this study transgenic plants expressing the tagged proteins were crossed and anti-tag coimmunoprecipitation assay undertaken. rweigel@gwdg.de Plant Cell (1040-4651) 2005 Interaction of NIMIN1 with NPR1 modulates PR gene expression in Arabidopsis. Interaction of NIMIN1 with NPR1 modulates PR gene expression in Arabidopsis. Plant Cell (1040-4651) 2005 Weigel RR., Pfitzner UM., Gatz C. In this study transgenic plants expressing the tagged proteins were crossed and anti-tag coimmunoprecipitation assay undertaken. rweigel@gwdg.de yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 hybrid three hybrid 3-hybrid tri hybrid tri-hybrid assay 3 hybrid predetermined predetermined participant predetermined Weigel RR., Pfitzner UM., Gatz C. In this study transgenic plants expressing the tagged proteins were crossed and anti-tag coimmunoprecipitation assay undertaken. rweigel@gwdg.de Plant Cell (1040-4651) 2005 q8l9w4_arath NPR1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTTIDGFADSYEISSTSFVATDNTDSSIVYLAAEQVLTGPDVSALQLLSNSFESVFDSPDDFYSDAKLVLSDGREVSFHRCVLSARSSFFKSALAAAKKEKDSNNTAAVKLELKEIAKDYEVGFDSVVTVLAYVYSSRVRPPPKGVSECADENCCHVACRPAVDFMLEVLYLAFIFRIPELVTLYQRHLLDVVDKVVIEDTLVILKLANICGKACMKLLDRCKEIIVKSNVDMVSLEKSLPEELVKEIIDRRKELGLEVPKVKKHVSNVHKALDSDDIELVKLLLKEDHTNLDDACALHFAVAYCNVKTATDLLKLDLADVNHRNPRGYTVLHVAAMRKEPQLILSLLEKGASASEATLEGRTALMIAKQATMAVECNNIPEQCKHSLKGRLCVEILEQEDKREPIPRDVPPSFAVAADELKMTLLDLENRVALAQRLFPTEAQAAMEIAEMKGTCEFIVTSLEPDRLTGTKRTSPGVKIAPFRILEEHQSRLKALSKTVELGKRFFPRCSAVLDQIMNCEDLTQLACGEDDTAEKRLQKKQRYMEIQETLKKAFSEDNLELGNSSLTDSTSSTSKSTGGKRSNRKFSHRRR A97B8448176E35E8 tga2_arath Transcription factor TGA2 TGA2 BZIP20 HBP1B At5g06950 MOJ9.12 HBP-1b homolog bZIP transcription factor 20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTSPRTDVSTDDDTDHPDLGSEGALVNTAASDSSDRSKGKMDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISGTGDQAHSTGGNGALAFDAEHSRWLEEKNKQMNELRSALNAHAGDSELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQLMGINNLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLTTRQSARALLAIHDYFSRLRALSSLWLARPRE D3033153BCE932C4 q39140-2 Transcription factor TGA6 TGA6 BZIP45 bZIP transcription factor 45 F28J15.6 MQC3.8 At3g12250 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MHSLNETVIPDVDYMQSDRGHMHAAASDSSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHSRWLEEKNRQMNELRSALNAHAGDTELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVMGINSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMLRVLTTRQSARALLAIHDYSSRLRALSSLWLARPRE May be due to an intron retention. No experimental confirmation available. 32324D50816801C5 nimi1_arath Protein NIM1-INTERACTING 1 At1g02450 NIMIN-1 T14P4.19 T6A9_28 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MYPKQFSLYNYSLETMSKDENVESKETIRVDKRVREDEEEEEEKKIDTFFKLIKHYQEARKRRREELAENSGVVRRKSNGGERSGIVVPAFQPEDFSQCRTGLKPPLMFVSDHKEENTKVEQEEDQTEERNEDKALDLNLAL 5C8EB7C4A7064B65 npr1-nimmin1-4 1 3 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9FNZ5:p.Phe50Ser Phenylalanine 49 serine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F S Wed May 02 20:10:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe50ser' Tue Jun 30 17:19:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe50Ser' Q9FNZ5:p.Phe50Ser Phenylalanine 50 serine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F S Wed May 02 15:42:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe50ser' Tue Jun 30 15:41:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe50Ser' physical association physical association npr1-nimmin1-5 2 3 unspecified role unspecified role ancillary ancillary 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig. 2A npr1-nimmin1-6 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role ancillary ancillary physical association physical association Fig. 2