IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. Oncogene (0950-9232) 2004 Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. Oncogene (0950-9232) 2004 Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. Oncogene (0950-9232) 2004 Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. Oncogene (0950-9232) 2004 Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. Oncogene (0950-9232) 2004 Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. Oncogene (0950-9232) 2004 Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. Oncogene (0950-9232) 2004 Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. Oncogene (0950-9232) 2004 Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. Oncogene (0950-9232) 2004 Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. Oncogene (0950-9232) 2004 Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1. Oncogene (0950-9232) 2004 Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hwang CY., Ryu YS., Chung MS., Kim KD., Park SS., Chae SK., Chae HZ., Kwon KS. A catalytically inactive Thioredoxin mutant was used in this study A cDNA library derived from human brain tissue was used in this study. Oncogene (0950-9232) 2004 csn5_human COP9 signalosome complex subunit 5 Jun activation domain-binding protein 1 COPS5 CSN5 JAB1 protein protein human Homo sapiens Human MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS DIP protein Q92905 original sequence version: 161 DIP protein Q92905 original sequence version: 87 DIP protein Q92905 original sequence version: 132 DIP protein Q92905 original sequence version: 149 DIP protein Q92905 original sequence version: 136 DIP protein Q92905 original sequence version: 101 B5742F4AAD03A1CF cdn1b_human Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 CDKN1B KIP1 protein protein human Homo sapiens Human MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT DIP protein P46527 original sequence version: 120 DIP protein P46527 original sequence version: 115 DIP protein P46527 original sequence version: 154 DIP protein P46527 original sequence version: 168 DIP protein P46527 original sequence version: 164 DIP protein P46527 original sequence version: 118 1118D58901CDF3FC thio_human Thioredoxin ATL-derived factor Surface-associated sulphydryl protein TXN TRDX TRX TRX1 protein protein human Homo sapiens Human MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV DIP protein P10599 original sequence version: 174 DIP protein P10599 original sequence version: 133 DIP protein P10599 original sequence version: 181 DIP protein P10599-1 original sequence version: 180 256F4E3C8A187693 trx-jab1 6 7 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait P10599:p.Cys35Ser Cystiene35serine mutation mutation certain certain sequence position certain certain certain sequence position certain C S Thu Jul 07 12:16:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys35ser Wed May 02 17:41:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys35ser' Tue Jun 30 19:14:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys35Ser' physical association physical association trx-jab1-1 2 7 unspecified role unspecified role prey prey s protein S protein tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait P10599:p.Cys35Ser Cystiene35serine mutation mutation certain certain sequence position certain certain certain sequence position certain C S Thu Jul 07 12:16:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys35ser Wed May 02 15:10:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys35ser' Tue Jun 30 19:57:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys35Ser' gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association trx-jab1-2 3 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association jab1-trx 3 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association trx-jab1-4 4 7 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P10599:p.Cys35Ser Cystiene35serine mutation mutation certain certain sequence position certain certain certain sequence position certain C S Thu Jul 07 12:07:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys35ser Wed May 02 19:47:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys35ser' Tue Jun 30 17:51:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys35Ser' physical association physical association trx-jab1-5 5 9 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey c terminal C terminal domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association trx-jab1-6 1 9 unspecified role unspecified role fluorescence donor fluorescence donor yfp yellow fluorescent protein tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept rfp red florescent protein tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction trx-jab1-cdn1b 5 8 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association The authors note that Cyclin-dependent kinase inhibitor 1B and Thioredoxin compete for binding to the COP9 signalosome complex subunit 5 protein.