MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The polarity-inducing kinase Par-1 controls Xenopus gastrulation in cooperation with 14-3-3 and aPKC. The polarity-inducing kinase Par-1 controls Xenopus gastrulation in cooperation with 14-3-3 and aPKC. EMBO J. (0261-4189) 2004 imex curation Kusakabe M., Nishida E. no Only protein-protein interactions in vitro In vitro experimental interac experimental interaction detection experimental interac nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kusakabe M., Nishida E. no EMBO J. (0261-4189) 2004 Only protein-protein interactions imex curation The polarity-inducing kinase Par-1 controls Xenopus gastrulation in cooperation with 14-3-3 and aPKC. The polarity-inducing kinase Par-1 controls Xenopus gastrulation in cooperation with 14-3-3 and aPKC. EMBO J. (0261-4189) 2004 imex curation Kusakabe M., Nishida E. no Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kusakabe M., Nishida E. no EMBO J. (0261-4189) 2004 Only protein-protein interactions imex curation q91569_xenla Protein kinase C prkci.L prkci protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MPTQRDNTMSQPSDHSHQVRVKAYFKGDIMITHFEPSITFDGLCNEVRDMCSFENDQPFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCIPEKPGMPCTGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHTIAESVIPMDPPGMHSDHSEPELPYRPRSQDNLDQVGEEKEAMNSRESGKSPSSLGLQDFNLMRVIGRGSYAKVLLVRLKKTERIYAMKVVKKELVNDDEDIDWVQQEKHVFEQASTIPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFILAEISLALNYLHEHGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWRALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDFLFQVILEKQIRIPRSLSVKAASVLKSFLNTDPKDRLGCHPQTGFADIQGHQFFRNVDWDLMEQKQVVPPFKPNISGEFGLDNFDAQFTNEPVQLTPDDEDVVRKIDQSEFEGFEYINPLLMSAEECV 8F8C5D9C82AAB141 q804t2_xenla Non-specific serine/threonine protein kinase mark3.L mark3 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSTRTPLPTVNERDTENHTSHGDGRQDVPTRSGRQGARARNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPSKRGTLEQIMKDRWINAGHEEDELKPFLEPELDIADQKRIDIMIGMGYSKEEIQESLSRMKFDEITATYLLFGRKSSELDASDSSSSSNLSLAKVRPNSDLNNSSGQSPHHKGRSISSSQKQRRYSDHAGPAVPAVTAYPKRSQTSTTDNDLKEEVGQSRKSSSIGRGVTPPSPMLGNANNPNKADIPDRKKSSVVPTTNSTSSGMTRRNTYVCNERAPTDRHSVIQNGKENSTIPDQRTSVASTHSITSTTTPDRMRFPRGTASRSTFHGQLRERRTATYNGPPASPSLSHEATPLSHTRSRGSTNLFSKLTSKLTRSRNVSGDQKDENKESKPRSLRFTWSMKTTSSMDPNDMMREIRKVLDANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL mint C7396693E7CD3F93 q8qgv3_xenla Non-specific serine/threonine protein kinase mark2.L MARK2 mark2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MTTRTPLPTVNERDADQPALGHADQKTSSGGSSKPNMLRCRTSIATTADEQPHIGNYRLLKTIGKGNFAKVKLARHVLTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKLIVHRDLKAENLLLDSDMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMRDRWMNVGHEEDELKPYVEPIPDYKDPKRTELMITMGYSREEISDSLVNQKYNEVMATYLLLGYRTSEMDNDNLTLKPRPPPDISNSIVTSPAHKVQRSVSANPKQRRLSDQAGPAIPNSNSYSKKTQSNNAENRRPEDEKESGRKSSSTVRVPPSPLSGLDRKKTTPTPSTNSVLSTGTNRSRNSPMLDRASLVPGSVQNGKDSFSTPGSRASTASAPATSARIRQHQKSMSTSVHPSKPAPSLEGNCDVQRPSTAPQRVPVASPSAHNISSSATERTNFPRGVSSRSTFHAGQVRQARDQQNLGFGSVSPASPSGNSQGRRGATGSIFSKFTSKFVRRNLSFRFPRRNPNEPEVKDRVESTRPHLSVVDKEKDKEDHRDSKPRSLRFTWSMKTTSSMEPNEMMREIQKVLDANNCQHESQEKYMLLCIHGSPGHDNYVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIASKIANDLKL DE56FB1B2093EC5C o57468_xenla ywhae.S ywhae XELAEV_18014582mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MEEREDLVYRAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKSICNDILDVLDKHLIPAASSGESKVFYYKMKGDYHRYLAEFAQGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEDQNKEALQDVEDENQ mint 1459137FA5090DF4 mark3-prkci 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation F3 phosphorylation@593 alanine scanning phosphorylation@646 alanine scanning mint ywhae-mark3 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O57468:p.Phe199Tyr mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F Y Wed Jul 06 16:22:00 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing ' Wed May 02 15:11:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe199tyr' Tue Jun 30 15:44:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe199Tyr' tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1205204: original sequence: 1-255 : MEEREDLVYRAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKSICNDILDVLDKHLIPAASSGESKVFYYKMKGDYHRYLAEFAQGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEDQNKEALQDVEDEN O57468:p.Glu183Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E K Wed May 02 16:09:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu183lys' Tue Jun 30 18:44:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu183Lys' O57468:p.Tyr214Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:59:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr214phe' Tue Jun 30 17:35:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr214Phe' Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association PKC activity is required for the binding of Par-1 to 14-3-3. PKC inhibitors (Staurosporine and Bis I) negatively affect the binding of Par-1 to 14-3-3 (F2D) 14-3-3 F2A F2B F2D mint mark3-ywhae-1 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q8QGV3:p.Ser646Ala mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing ' Wed May 02 15:46:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser646ala' Tue Jun 30 17:49:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser646Ala' tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8QGV3:p.[Thr593Ala;Ser646Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:17:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr593ala,ser646ala' Tue Jun 30 17:38:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr593Ala;Ser646Ala]' Q8QGV3:p.Thr593Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T A Wed May 02 16:18:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr593ala' Tue Jun 30 17:52:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr593Ala' Stoichiometry: 1.0 physical association physical association F4A mint