IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Toc12, a novel subunit of the intermembrane space preprotein translocon of chloroplasts. Toc12, a novel subunit of the intermembrane space preprotein translocon of chloroplasts. Mol. Biol. Cell (1059-1524) 2004 Becker T., Hritz J., Vogel M., Caliebe A., Bukau B., Soll J., Schleiff E. Outer envelope membranes of Pisum sativum chloroplasts were isolated and solubilized prior to the pull down assay. Figure 7 (F). Figure 9 (A). schleiff@botanik.biologie.unimuenchen.de in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Becker T., Hritz J., Vogel M., Caliebe A., Bukau B., Soll J., Schleiff E. Outer envelope membranes of Pisum sativum chloroplasts were isolated and solubilized prior to the pull down assay. Figure 7 (F). Figure 9 (A). schleiff@botanik.biologie.uni-muenchen.de schleiff@botanik.biologie.unimuenchen.de Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Biol. Cell (1059-1524) 2004 Toc12, a novel subunit of the intermembrane space preprotein translocon of chloroplasts. Toc12, a novel subunit of the intermembrane space preprotein translocon of chloroplasts. Mol. Biol. Cell (1059-1524) 2004 Becker T., Hritz J., Vogel M., Caliebe A., Bukau B., Soll J., Schleiff E. Outer envelope membranes of Pisum sativum chloroplasts were isolated and solubilized prior to the pull down assay. Figure 7 (F). Figure 9 (A). schleiff@botanik.biologie.unimuenchen.de in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Becker T., Hritz J., Vogel M., Caliebe A., Bukau B., Soll J., Schleiff E. Outer envelope membranes of Pisum sativum chloroplasts were isolated and solubilized prior to the pull down assay. Figure 7 (F). Figure 9 (A). schleiff@botanik.biologie.uni-muenchen.de schleiff@botanik.biologie.unimuenchen.de Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Biol. Cell (1059-1524) 2004 Toc12, a novel subunit of the intermembrane space preprotein translocon of chloroplasts. Toc12, a novel subunit of the intermembrane space preprotein translocon of chloroplasts. Mol. Biol. Cell (1059-1524) 2004 Becker T., Hritz J., Vogel M., Caliebe A., Bukau B., Soll J., Schleiff E. Outer envelope membranes of Pisum sativum chloroplasts were isolated and solubilized prior to the pull down assay. Figure 7 (F). Figure 9 (A). schleiff@botanik.biologie.unimuenchen.de in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Becker T., Hritz J., Vogel M., Caliebe A., Bukau B., Soll J., Schleiff E. Outer envelope membranes of Pisum sativum chloroplasts were isolated and solubilized prior to the pull down assay. Figure 7 (F). Figure 9 (A). schleiff@botanik.biologie.uni-muenchen.de schleiff@botanik.biologie.unimuenchen.de Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Biol. Cell (1059-1524) 2004 toc34_pea Translocase of chloroplast 34 34 kDa chloroplast outer envelope protein GTP-binding protein OEP34 GTP-binding protein IAP34 TOC34 IAP34 OEP34 protein protein pea Pisum sativum (Garden pea) Garden pea MASQQQTVREWSGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKDAQASDIPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQTITEVALNKSESIFVDKNLIDGPNPNQRGKLWIPLIFALQYLFLAKPIEALIRRDIATETKPAWETRDVGDRK DIP protein Q41009 original sequence version: 60 DIP protein Q41009 original sequence version: 90 00D5E79735BF041F tic22_pea Protein TIC 22, chloroplastic TIC22 IAP25 Translocon at the inner envelope membrane of chloroplasts 22 protein protein pea Pisum sativum (Garden pea) Garden pea MESQGQWNPLLSFSRFINHHSNHLATRLEETKRLAGTLIQSHTRTKPAFAATLTPNHVAKSLAGTSVYTVSNSDNEFVLMSDAEGAKSIGLLCFRQEDAEAFLAQVRSRKKEFRGGAKVVPITLDQVYMLKVEGIAFRFLPDPVQIKNALELRAANRGSFDGVPVFQSDLLVVKKKNKRYCPVYFSKEDLEYELSKVSRSSKGVGVSQHIMVGSFEDVLKKMELSEKSSGWEDLVFIPPGKKHSQHMQEVIA 722F44E1F39C3CD5 toc64_pea Translocon at the outer membrane of chloroplasts 64 TOC64 protein protein pea Pisum sativum (Garden pea) Garden pea MKSMASPSSQIWVILGLGLAGIYVLTRKLTQAVKEDFGAFLLKLKLLPPPPPAPPKAPHPLSSLNFAISDIFDIEGHVSTFGHPEWARTHEPASSTASAVSALVESGATCIGTTVVDELAYGISGENKHFGTPTNPAVPNRVPGGSSSGAAVAVAANFVDFSLGVDTSGGVRVPAGFCGILGFRPSHGAVSHVGIIPVSTSLDTVGWFAKDPDVLRRVGHILLQAPFVMQRNPRQIIIADDCFQHLNVPLDRTSQVVIKATEKLFGKQVLKHINFEDYISSKVSSLKACSIQKSNGVLKSSSLKLLANVMQSLQRHEFEHTHSEWMSIVKPDLHPAVSAQLHEKFEVSELEIENSKSVRSELRVAVNSLLKDEGVLVIPTVADPPPKLGGKEFLSHDYQSRALSLLSIASISGCCQVTVPLGFFDKNPVSVSLIARHGGDRFLLDTLKTMYTVLQEQADIAAPSKSSKSVVSKEQSAEISKEKGNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLELGSYLQAEEDCTTAISFDKKNVKAYFRRGTAREMLGYYKEAIDDFKYALVLEPTNKRAASSAERLRKLFQ 084E16C7E54E663B q9lkr1_pea protein protein pea Pisum sativum (Garden pea) Garden pea MDSQTLSSSSQFHEPNNLLNGVNGHGSDSDSDDGFVSGEDEAEPSTPILVYDAKSTVQVKEKEEESFDQESPRPIAKVTADDEDEAEEEEDDSQGVGLEKEGGGGGGKDVEEVKEDEVFVEANDKGFESVDSEGGDVVGEEINNGLREEGDGGTEIETVRSDSVVVEPVSVDNSGVGVVENGDGVVDNEKLTSGGDFVVDSLRVNPLVDGGVAVVGDEVKDEVSEIDGAVAPAPVASLDNSFEAIEKVGSRSVVDEVGSSFETIEKGDEVVVDDEVVGGDVEPSKVVDSGVEIEVDDNVAHEQLSDVVLTEKAGDVVVDENVGVGAKPDEVVDIGVDEGVAQRQVSDIAPAEKGEEISEVVSQSLEAAEDEINIENRVVEGGIESRVVEGGIESRVDDAVEGEVGSNVVEVEDGSNVDNVAEKDAVSNVDDAAEKDAVSNVDRVVEVEDESHVGNTVEGEARSNADHVLQVEDETHLDNAAVGEAKSNADRVVEVEDETPLDNAAVGEAESNVDPAVKVEDDTRFDNGAEGEAESNVDRVGEVEDDTHFDNAVEEEAESNVDRVVEVEDDTHFDNAVEEEADSNVDRVIEMDDGSHVEAAVDHHIDREIDDLLSDSKDESMIFGGSDSANKYLEELEKQIRDSESSQGDRIDGQIVTDSDEEDVSDEEGGSKELFDTATLAALLKAASGAGGEDGGGITLTAQDGSRLFSVERPAGLGPSLQTGKPAVRSIRPNLFAPSMSRAGTVVSDTDLSEEDKKKLEKLQEIRIKYLRVIQRLGFTTEESIAAQVLYRLTLVAGRQIGEMFSLDAAKESASRLEAEGRDDFAFSLNILVLGKTGVGKSATINSIFGETKTSFSAYGPATTSVTEIVGMVDGVEIRVFDTPGLKSSAFEQSYNRKVLSTVKKLTKKSPPDIVLYVDRLDLQTRDMNDLPMLRSVTSALGPTIWRNVIVTLTHAASAPPDGPSGSPLSYDVFVAQRSHIVQQAIGQAVGDLRLMNPNLMNPVSLVENHPSCRKNRDGQKVLPNGQSWKPLLLLLCYSMKILSEATNISKTQEAADNRRLFGFRSRAPPLPYLLSWLLQSRAHPKLPDQAGIDNGDSDIEMADLSDSDGEEGEDEYDQLPPFKPLKKSQIAKLNGEQRKAYLEEYDYRVKLLQKKQWREELKRMRDMKKRGKNGENDYMEEDEENGSPAAVPVPLPDMVLPQSFDSDNPAYRYRFLEPNSQLLTRPVLDTHSWDHDCGYDGVNIENSMAIINKFPAAVTVQVTKDKQDFSIHLDSSVAAKHGENGSTMAGFDIQNIGKQLAYIVRGETKFKNFKRNKTAAGVSVTFLGENVSTGVKLEDQIALGKRLVLVGSTGTVRSQNDSAYGANVEVRLREADFPVGQDQSSLSLSLVQWRGDLALGANFQSQISLGRSYKMAVRAGLNNKLSGQINVRTSSSDQLQIALIAILPVAKAIYKNFWPGVTENYSIY AA18A7C3DB5746C4 toc75_pea Protein TOC75, chloroplastic 75 kDa translocon at the outer-envelope membrane of chloroplasts Import intermediate-associated protein of 75 kDa 75 kDa chloroplast outer envelope protein TOC75 IAP75 OEP75 protein protein pea Pisum sativum (Garden pea) Garden pea MRTSVIPNRLTPTLTTHPSRRRNDHITTRTSSLKCHLSPSSGDNNDSFNSSLLKTISTTVAVSSAAASAFFLTGSLHSPFPNFSGLNAAAGGGAGGGGGGSSSSGGGGGGWFNGDEGSFWSRILSPARAIADEPKSEDWDSHELPADITVLLGRLSGFKKYKISDILFFDRNKKSKVETQDSFLDMVSLKPGGVYTKAQLQKELESLATCGMFEKVDMEGKTNADGSLGLTISFAESMWERADRFRCINVGLMGQSKPVEMDPDMSEKEKIEFFRRQEREYKRRISSARPCLLPTSVHEEIKDMLAEQGRVSARLLQKIRDRVQSWYHEEGYACAQVVNFGNLNTREVVCEVVEGDITKLSIQYLDKLGNVVEGNTEGPVVQRELPKQLLPGHTFNIEAGKQALRNINSLALFSNIEVNPRPDEMNEGSIIVEIKLKELEQKSAEVSTEWSIVPGRGGRPTLASLQPGGTITFEHRNLQGLNRSLTGSVTTSNFLNPQDDLAFKMEYAHPYLDGVDNPRNRTLRVSCFNSRKLSPVFTGGPGVDEVPSIWVDRAGVKANITENFSRQSKFTYGLVMEEIITRDESNHICSNGQRVLPNGAISADGPPTTLSGTGIDRMAFLQANITRDNTRFVNGTIVGSRNMFQVDQGLGVGSNFPFFNRHQLTVTKFLQLMSVEEGAGKSPPPVLVLHGHYGGCVGDLPSYDAFTLGGPYSVRGYNMGEIGAARNILELAAEIRIPIKGTHVYAFAEHGTDLGSSKDVKGNPTVVYRRMGQGSSYGAGMKLGLVRAEYAVDHNSGTGAVFFRFGERF AFE51AE75F0617C5 hsp7s_pea Stromal 70 kDa heat shock-related protein, chloroplastic HSP70 ST70 protein protein pea Pisum sativum (Garden pea) Garden pea MASSAQIHGLGTASFSSLKKPSSISGNSKTLFFGQRLNSNHSPFTRAAFPKLSSKTFKKGFTLRVVSEKVVGIDLGTTNSAVAAMEGGKPTIITNAEGQRTTPSVVAYTKNGDRLVGQIAKRQAVVNPENTFFSVKRFIGRKMSEVDEESKQVSYRVIRDDNGNVKLDCPAIGKSFAAEEISAQVLRKLVDDASKFLNDKVTKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFERKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKRVVDWLAGDFKRDEGIDLLKDKQALQRLTETAEKAKMELSSLSQTNISLPFITATADGPKHIETTLTRAKFEELCSDLLDRLRTPVENSLRDAKLSIKDIDEVILVGGSTRIPAVQELVKKLIGKDPNVTVNPDEVVALGAAVQAGVLAGDVSDIVLLDVSPLSLGLETLGGVMTKIIPRNTTLPTSKSEVFSTAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPGDEVERMVSEAERFSKEDKEKREAIDTKNQADSVVYQTEKQLKELGEKVPAPVKEKVEAKLGELKEAITGGSTQTIKDALAALNQEVMQLGQSLYNQPGAAGQAGPTPPGSESGPSESSGKEGPEGDVIDADFTDSK B3E0A1F4C9735D7B q5qjd5_pea protein protein pea Pisum sativum (Garden pea) Garden pea MAATTTAGVIGGIGSGVSWMQFGRKEKKQNKMNTVTVCCSSYSSSVTDPYKILKVQPDASESDVRKAFRQLALQYHPDVCRGKDCDVQFHVINEAYVVSYYYL 0D63758CC17CE749 toc complex-5 2 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-639027]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 104-104, sequence length 103 [EBI-639027]49-104 ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 9 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 6 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea association association toc complex-6 2 4 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 5 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 9 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 6 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 10 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea association association toc34-toc64 2 6 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 4 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Authors specify the C-terminal region of the Toc34 protein as containing the interacting domain with Toc64. Co-ordinates of the C-terminal region not given in report. toc complex-7 2 6 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 5 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 10 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea association association toc64-hsp7s-2 1 10 unspecified role unspecified role neutral component neutral component pea Pisum sativum (Garden pea) Garden pea 5 unspecified role unspecified role neutral component neutral component pea Pisum sativum (Garden pea) Garden pea 6 unspecified role unspecified role neutral component neutral component pea Pisum sativum (Garden pea) Garden pea 9 unspecified role unspecified role neutral component neutral component pea Pisum sativum (Garden pea) Garden pea physical association physical association toc complex-2 3 8 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 4 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 6 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 10 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pea Pisum sativum (Garden pea) Garden pea association association The presence of Tic22 was not tested here. In another assay using Toc 12 (residues 48 -103) the presence of Tic22 within a complex of Toc12, Toc34 and Toc64 was demonstrated. toc complex-3 3 6 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 5 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 4 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 10 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-639820]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 104-104, sequence length 103 [EBI-639820]49-104 region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pea Pisum sativum (Garden pea) Garden pea association association The presenece of Toc75 was not tested for here. Toc75 had been shown to be present when full length Toc12 was used as bait in a previous assay. toc complex-4 3 8 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 7 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 5 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 9 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 4 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 10 unspecified role unspecified role prey prey pea Pisum sativum (Garden pea) Garden pea 6 unspecified role unspecified role bait bait pea Pisum sativum (Garden pea) Garden pea association association