IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. EMBO J. (0261-4189) 2004 Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. EMBO J. (0261-4189) 2004 Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. EMBO J. (0261-4189) 2004 Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis No Bcl-xL and Bax do not normally bind one another in the cytosol of healthy cells, nonionic detergents such as Triton X-100 will initiate heterodimer formation. Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. EMBO J. (0261-4189) 2004 Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. EMBO J. (0261-4189) 2004 Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. EMBO J. (0261-4189) 2004 Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. EMBO J. (0261-4189) 2004 Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. EMBO J. (0261-4189) 2004 Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. EMBO J. (0261-4189) 2004 Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. EMBO J. (0261-4189) 2004 Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. EMBO J. (0261-4189) 2004 Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. EMBO J. (0261-4189) 2004 q64373-1 Bcl-2-like protein 1 Bcl2l1 Bcl2l Bclx Apoptosis regulator Bcl-X Bcl-xL protein protein mouse Mus musculus Mouse MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK 24D2AC79887E072E bad_human Bcl2-associated agonist of cell death Bcl-2-binding component 6 Bcl-2-like protein 8 BAD BBC6 BCL2L8 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein human Homo sapiens Human MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ DIP protein Q92934 original sequence version: 66 DIP protein Q92934 original sequence version: 121 69FD8D27DDEE3241 q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 bclxl-bclxl-1 4 9 unspecified role unspecified role neutral component neutral component physical association physical association bclxl-bclxl-2 5 9 unspecified role unspecified role neutral component neutral component physical association physical association bclxl-bclxl-3 3 9 unspecified role unspecified role neutral component neutral component physical association physical association bclxl-bclxl-4 6 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association bclxl-bclxl-5 1 9 unspecified role unspecified role prey prey Q07817-1:p.Lys233Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:38:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys233ala' Tue Jun 30 18:42:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys233Ala' Q07817-1:p.Arg232Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:35:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg232ala' Tue Jun 30 16:55:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg232Ala' region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-700952]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 234-234, sequence length 233 [EBI-700952]214-234 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The presence of basic amino acids in the C-tail is required for homodimerization, Bcl-xL insertion into the mitochondrial targeting membrane and protection against induced cell death By BAD, which heterodimerizes with BCL-XL bclxl-bclxl-6 1 9 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-700962]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 234-234, sequence length 233 [EBI-700962]214-234 Q07817-1:p.Arg232Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Wed May 02 18:37:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg232ala' Tue Jun 30 18:50:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg232Ala' Q07817-1:p.Lys233Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 16:30:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys233ala' Tue Jun 30 15:50:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys233Ala' physical association physical association The presence of basic amino acids in the C-tail is required for homodimerization, Bcl-xL insertion into the mitochondrial targeting membrane and protection against induced cell death bclxl-bad-1 1 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey physical association physical association bclxl-bclxl-7 1 9 unspecified role unspecified role prey prey Q07817-1:p.Gly138Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Wed May 02 17:49:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly138ala' Tue Jun 30 20:22:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly138Ala' 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association bclxl-bax-1 2 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-701137]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 234-234, sequence length 233 [EBI-701137]214-234 physical association physical association bclxl-bax-2 2 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-701142]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 234-234, sequence length 233 [EBI-701142]214-234 Q07817-1:p.Leu226Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:42:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu226ala' Tue Jun 30 20:21:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu226Ala' Q07817-1:p.Leu226Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 20:00:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu226ala' Tue Jun 30 17:48:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu226Ala' Q07817-1:p.Gly227Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Wed May 02 15:32:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly227ala' Tue Jun 30 19:03:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly227Ala' physical association physical association bclxl-bax-3 2 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-701149]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 193-193, sequence length 192 [EBI-701149]170-193 physical association physical association