IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Analysis of the interaction of a hybrid system consisting of bovine adrenodoxin reductase and flavodoxin from the cyanobacterium Anabaena PCC 7119. Analysis of the interaction of a hybrid system consisting of bovine adrenodoxin reductase and flavodoxin from the cyanobacterium Anabaena PCC 7119. Bioelectrochemistry (1567-5394) 2004 Zollner A., Nogues I., Heinz A., Medina M., Gomez-Moreno C., Bernhardt R. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking experiment was performed with 1-ethyl-3-3-(3-dimethylamino propyl) carbodiimide (EDC). The proteins were then separated on SDS-PAGE. fig 1a in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zollner A., Nogues I., Heinz A., Medina M., Gomez-Moreno C., Bernhardt R. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking experiment was performed with 1-ethyl-3-3-(3-dimethylamino propyl) carbodiimide (EDC). The proteins were then separated on SDS-PAGE. fig 1a Bioelectrochemistry (1567-5394) 2004 Analysis of the interaction of a hybrid system consisting of bovine adrenodoxin reductase and flavodoxin from the cyanobacterium Anabaena PCC 7119. Analysis of the interaction of a hybrid system consisting of bovine adrenodoxin reductase and flavodoxin from the cyanobacterium Anabaena PCC 7119. Bioelectrochemistry (1567-5394) 2004 Zollner A., Nogues I., Heinz A., Medina M., Gomez-Moreno C., Bernhardt R. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking experiment was performed with 1-ethyl-3-3-(3-dimethylamino propyl) carbodiimide (EDC). The proteins were then separated on SDS-PAGE. fig 1a in vitro In vitro bifunctional agent crosslink protein cross-linking with a bifunctional reagent Label transfer techniques Photoaffinity labelling Label transfer techniques Photoaffinity labelling bifunctional agent crosslink predetermined predetermined participant predetermined Zollner A., Nogues I., Heinz A., Medina M., Gomez-Moreno C., Bernhardt R. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking experiment was performed with 1-ethyl-3-3-(3-dimethylamino propyl) carbodiimide (EDC). The proteins were then separated on SDS-PAGE. fig 1a Bioelectrochemistry (1567-5394) 2004 Analysis of the interaction of a hybrid system consisting of bovine adrenodoxin reductase and flavodoxin from the cyanobacterium Anabaena PCC 7119. Analysis of the interaction of a hybrid system consisting of bovine adrenodoxin reductase and flavodoxin from the cyanobacterium Anabaena PCC 7119. Bioelectrochemistry (1567-5394) 2004 Zollner A., Nogues I., Heinz A., Medina M., Gomez-Moreno C., Bernhardt R. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking experiment was performed with 1-ethyl-3-3-(3-dimethylamino propyl) carbodiimide (EDC). The proteins were then separated on SDS-PAGE. fig 1a in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Zollner A., Nogues I., Heinz A., Medina M., Gomez-Moreno C., Bernhardt R. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking experiment was performed with 1-ethyl-3-3-(3-dimethylamino propyl) carbodiimide (EDC). The proteins were then separated on SDS-PAGE. fig 1a Bioelectrochemistry (1567-5394) 2004 adro_bovin NADPH:adrenodoxin oxidoreductase, mitochondrial Ferredoxin--NADP(+) reductase FDXR ADXR protein protein bovin Bos taurus (Bovine) Bovine MAPRCWRWWPWSSWTRTRLPPSRSIQNFGQHFSTQEQTPQICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEKPGVEEAARRASASRAWGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGIGEATRAVPTGDVEDLPCGLVLSSIGYKSRPIDPSVPFDPKLGVVPNMEGRVVDVPGLYCSGWVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSGPRPGSAFIKALLDSRGVWPVSFSDWEKLDAEEVSRGQASGKPREKLLDPQEMLRLLGH E68F6F5D18F53131 adx_bovin Adrenodoxin, mitochondrial Adrenal ferredoxin Ferredoxin-1 Hepato-ferredoxin FDX1 ADX protein protein bovin Bos taurus (Bovine) Bovine MAARLLRVASAALGDTAGRWRLLARPRAGAGGLRGSRGPGLGGGAVATRTLSVSGRAQSSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE F0F2EE027BFAC371 fenr_nosso Ferredoxin--NADP reductase petH protein protein anaso Anabaena sp. (strain PCC 7119) MSNQGAFDGAANVESGSRVFVYEVVGMRQNEETDQTNYPIRKSGSVFIRVPYNRMNQEMQRITRLGGKIVTIQTVSALQQLNGRTTIATVTDASSEIAKSEGNGKATPVKTDSGAKAFAKPPAEEQLKKKDNKGNTMTQAKAKHADVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY 8E1F61D0F09338B6 flav_nosso Flavodoxin isiB protein protein anaso Anabaena sp. (strain PCC 7119) MSKKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTWNIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL 069E8DEBA9E33302 isib-peth-1 2 6 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fld and FNR in oxidized form are used. stoichiometry 1:1 isib-fdxr-1 2 4 unspecified role unspecified role neutral component neutral component mature form binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fld and AdR in oxidized form are used. Complex of stoichiometry 1:1 but also higher stoichiometries are observed isib-peth-2 1 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Fld and FNR in oxidized form are used. Reduction rate. red= reduced form, ox= oxidized form. FNRred + Fldox : 1.8 s-1, Fldred + FNRox : 5300 s-1 isib-fdxr-2 1 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey mature form binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fld and AdR in oxidized form are used. Reduction rate. red= reduced form, ox= oxidized form. AdRred + Fldox : 0.03 s-1, Fldred + AdRox : 0.6 s-1 fdx1-fdxr-1 1 5 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey mature form binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Adx and AdR in oxidized form are used. Reduction rate. red= reduced form, ox= oxidized form. AdRred + Adxox : 7.3 s-1, Adxred + AdRox : no reaction fdx1-peth-3 1 5 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Adx and FNR in oxidized form are used. Reduction rate. red= reduced form, ox= oxidized form. FNRred + Adxox : 0.003 s-1, Adxred + FNRox : not detectable isib-fdxr-3 3 4 unspecified role unspecified role neutral component neutral component mature form binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fld in oxidized form and AdR in reduced form are used. The rate-limiting step of this reaction seems to be the formation of a production complex in which electron transfer is possible as shown by the decrease of reaction when increasing Fld/Adr ratio.