IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structure of mammalian protein geranylgeranyltransferase type-I. Structure of mammalian protein geranylgeranyltransferase type-I. EMBO J. (0261-4189) 2003 Taylor JS., Reid TS., Terry KL., Casey PJ., Beese LS. Geranylgeranyl transferase was cocrystalized with a peptide substrate thanks to the use of geranylgeranyl diphosphate (GGPP) analog : 3'Azogergeranylgeranyl diphosphate in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Taylor JS., Reid TS., Terry KL., Casey PJ., Beese LS. Geranylgeranyl transferase was cocrystalized with a peptide substrate thanks to the use of geranylgeranyl diphosphate (GGPP) analog : 3'Azogergeranylgeranyl diphosphate EMBO J. (0261-4189) 2003 Structure of mammalian protein geranylgeranyltransferase type-I. Structure of mammalian protein geranylgeranyltransferase type-I. EMBO J. (0261-4189) 2003 Taylor JS., Reid TS., Terry KL., Casey PJ., Beese LS. Geranylgeranyl transferase was cocrystalized with a peptide substrate thanks to the use of geranylgeranyl diphosphate (GGPP) analog : 3'Azogergeranylgeranyl diphosphate in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Taylor JS., Reid TS., Terry KL., Casey PJ., Beese LS. Geranylgeranyl transferase was cocrystalized with a peptide substrate thanks to the use of geranylgeranyl diphosphate (GGPP) analog : 3'Azogergeranylgeranyl diphosphate EMBO J. (0261-4189) 2003 pgtb1_rat Geranylgeranyl transferase type-1 subunit beta Geranylgeranyl transferase type I subunit beta Type I protein geranyl-geranyltransferase subunit beta Pggt1b protein protein rat Rattus norvegicus (Rat) Rat MAATEDDRLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDMLDSLDVVNKDDIIEWIYSLQVLPTEDRSNLDRCGFRGSSYLGIPFNPSKNPGTAHPYDSGHIAMTYTGLSCLIILGDDLSRVDKEACLAGLRALQLEDGSFCAVPEGSENDMRFVYCASCICYMLNNWSGMDMKKAISYIRRSMSYDNGLAQGAGLESHGGSTFCGIASLCLMGKLEEVFSEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLKLLKIFQYTNFEKNRNYILSTQDRLVGGFAKWPDSHPDALHAYFGICGLSLMEESGICKVHPALNVSTRTSERLRDLHQSWKTKDSKQCSDNVHISS DIP protein P53610 original sequence version: 107 AADEC7301A4A4011 fnta_rat Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha CAAX farnesyltransferase subunit alpha Ras proteins prenyltransferase subunit alpha FTase-alpha Type I protein geranyl-geranyltransferase subunit alpha Fnta protein protein rat Rattus norvegicus (Rat) Rat MAATEGVGESAPGGEPGQPEQPPPPPPPPPAQQPQEEEMAAEAGEAAASPMDDGFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSRESDIPASV DIP protein Q04631 original sequence version: 124 DIP protein Q04631 original sequence version: 118 DIP protein Q04631 original sequence version: 130 DFFFECC1B88BC080 rras2_human Ras-related protein R-Ras2 Ras-like protein TC21 Teratocarcinoma oncogene RRAS2 TC21 protein protein human Homo sapiens Human MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF BA7D4759DC49446F pgt1-rras2-2 2 5 unspecified role unspecified role neutral component neutral component caax motif binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-602723]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 205-205, sequence length 204 [EBI-602723]202-205 kkksktk tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 4 unspecified role unspecified role neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 3 unspecified role unspecified role neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association 2.40A working 21.4%, free 23.4% the TC21 peptide used does not match 100% the entry, it has been mutated to make it more soluble: KKKSKTKCVIF pgt1-rras2-3 1 5 unspecified role unspecified role neutral component neutral component caax motif binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-602737]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 205-205, sequence length 204 [EBI-602737]202-205 kkksktk tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range gg-cys201 sgergercys S-geranylgeranyl-L-cysteine 2-amino-3-(3,7,11,15-tetramethyl-2,6,10,14-hexadecatetraenylthio)propanoic acid LIPID S-geranylgeranyl cysteine S-geranylgeranyl-L-cysteine (2R)-2-amino-3-([(2E,6E,10Z)-12-hydroxy-3,7,11-trimethyldodeca-2,6,10-trien-1-yl]sulfanyl)propanoic acid Geranyl-geranyl GeranylGeranyl S-geranylgeranyl SGergerCys geranylgeranylc certain certain sequence position certain certain certain sequence position certain in vitro In vitro 4 unspecified role unspecified role neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 3 unspecified role unspecified role neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association 2.80A working 20.0%, free 21.8% the TC21 peptide used does not match 100% the entry, it has been mutated to make it more soluble: KKKSKTKCVIF pgt1-rras2-4 1 5 unspecified role unspecified role neutral component neutral component caax motif binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-602752]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 205-205, sequence length 204 [EBI-602752]202-205 kkksktk tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range gg-cys201 sgergercys S-geranylgeranyl-L-cysteine 2-amino-3-(3,7,11,15-tetramethyl-2,6,10,14-hexadecatetraenylthio)propanoic acid LIPID S-geranylgeranyl cysteine S-geranylgeranyl-L-cysteine (2R)-2-amino-3-([(2E,6E,10Z)-12-hydroxy-3,7,11-trimethyldodeca-2,6,10-trien-1-yl]sulfanyl)propanoic acid Geranyl-geranyl GeranylGeranyl S-geranylgeranyl SGergerCys geranylgeranylc certain certain sequence position certain certain certain sequence position certain in vitro In vitro 3 unspecified role unspecified role neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 4 unspecified role unspecified role neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association 2.60A working 19.4%, free 21.4% This structure also contain a GGPP not covalently attached to the peptide the TC21 peptide used does not match 100% the entry, it has been mutated to make it more soluble: KKKSKTKCVIF