MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Retrograde signaling is regulated by the dynamic interaction between Rtg2p and Mks1p. Retrograde signaling is regulated by the dynamic interaction between Rtg2p and Mks1p. Mol. Cell (1097-2765) 2003 Liu Z., Sekito T., Spírek M., Thornton J., Butow RA. no yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Liu Z., Sekito T., Spírek M., Thornton J., Butow RA. no Mol. Cell (1097-2765) 2003 mks1_yeast Negative regulator of RAS-cAMP pathway MKS1 LYS80 YNL076W N2344 N2347 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSREAFDVPNIGTNKFLKVTPNLFTPERLNLFDDVELYLTLIKASKCVEQGERLHNISWRILNKAVLKEHNINRSKKRDGVKNIYYVLNPNNKQPIKPKQAAVKQPPLQKANLPPTTAKQNVLTRPMTSPAIAQGAHDRSLDNPNSTNNDVKNDVAPNRQFSKSTTSGLFSNFADKYQKMKNVNHVANKEEPQTIITGFDTSTVITKKPLQSRRSRSPFQHIGDMNMNCIDNETSKSTSPTLENMGSRKSSFPQKESLFGRPRSYKNDQNGQLSLSKTSSRKGKNKIFFSSEDEDSDWDSVSNDSEFYADEDDEEYDDYNEEEADQYYRRQWDKLLFAKNQQNLDSTKSSVSSANTINSNTSHDPVRKSLLSGLFLSEANSNSNNHNTAHSEYASKHVSPTPQSSHSNIGPQPQQNPPSANGIKQQKPSLKTSNVTALASLSPPQPSNNERLSMDIQKDFKTDNESNHLYESNAPLTAQTILPTALSTHMFLPNNIHQQRMAIATGSNTRHRFSRRQSMDIPSKNRNTGFLKTRMEISEEEKMVRTISRLDNTSIANSNGNGNDDTSNQRTEALGRKTSNGGRI 79B0EE5F8DDE0145 rtg2_yeast Retrograde regulation protein 2 NRF588 RTG2 YGL252C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTLSDSDTETEVVSRNLCGIVDIGSNGIRFSISSKAAHHARIMPCVFKDRVGLSLYEVQYNTHTNAKCPIPRDIIKEVCSAMKRFKLICDDFGVPETSVRVIATEATRDAINADEFVNAVYGSTGWKVEILGQEDETRVGIYGVVSSFNTVRGLYLDVAGGSTQLSWVISSHGEVKQSSKPVSLPYGAGTLLRRMRTDDNRALFYEIKEAYKDAIEKIGIPQEMIDDAKKEGGFDLWTRGGGLRGMGHLLLYQSEGYPIQTIINGYACTYEEFSSMSDYLFLKQKIPGSSKEHKIFKVSDRRALQLPAVGLFMSAVFEAIPQIKAVHFSEGGVREGSLYSLLPKEIRAQDPLLIASRPYAPLLTEKYLYLLRTSIPQEDIPEIVNERIAPALCNLAFVHASYPKELQPTAALHVATRGIIAGCHGLSHRARALIGIALCSRWGGNIPESEEKYSQELEQVVLREGDKAEALRIVWWTKYIGTIMYVICGVHPGGNIRDNVFDFHVSKRSEVETSLKELIIDDANTTKVKEESTRKNRGYEVVVRISKDDLKTSASVRSRIITLQKKVRKLSRGSVERVKIGVQFYEE 050DBCA65E38666F 050DBCA65E38666F bmh1_yeast Protein BMH1 YER177W BMH1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTSREDSVYLAKLAEQAERYEEMVENMKTVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELICSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNASLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMSESGQAEDQQQQQQHQQQQPPAAAEGEAPK 0A234167E313688B 0A234167E313688B rtg2-mks1 1 RTG2 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 MKS1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F2B mint mks1-rtg2 1 MKS1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 RTG2 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:48:27 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing ' Stoichiometry: 1.0 physical association physical association F3C mint bmh1-mks1 1 MKS1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 BMH1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5C mint mks1-bmh1 1 BMH1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 MKS1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5D mint