IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. Nature (0028-0836) 2003 Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. Directed yeast two hybrid assay used in this study. Nature (0028-0836) 2003 BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. Nature (0028-0836) 2003 Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. Nature (0028-0836) 2003 BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. Nature (0028-0836) 2003 Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. Nature (0028-0836) 2003 BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. Nature (0028-0836) 2003 Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. Nature (0028-0836) 2003 BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. BTB proteins are substrate-specific adaptors in an SCF-like modular ubiquitin ligase containing CUL-3. Nature (0028-0836) 2003 Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Xu L., Wei Y., Reboul J., Vaglio P., Shin TH., Vidal M., Elledge SJ., Harper JW. Nature (0028-0836) 2003 cul3_caeel Cullin-3 cul-3 Y108G3AL.1 protein protein caeel Caenorhabditis elegans MSGRSGNGGQQKMRIRPFMATIDEQYVTQTWELLKRAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGERLYNGLKDVIQDHMASVRIRIIESMNSGSFLETVAESWADHTVAMVMIRDILMYMDRIYVAQNNHVLPVYNLGLDAYRTEILRQNGIGDRIRDALLELIKLDRKSNQINWHGIKNACDMLISLGIDSRTVYEDEFERPLLKETSDYYRDVCKNWLSGDNDACFYLAQVEIAMHDEASRASRYLDKMTEAKILQVMDDVMVAEHIQTIVYMQNGGVKFMLEHKKIEDLTRIFRIFKRIGDSVTVPGGGLKALLKAVSEYLNETGSNIVKNEDLLKNPVNFVNELLQLKDYFSSLLTTAFADDRDFKNRFQHDFETFLNSNRQSPEFVALYMDDMLRSGLKCVSDAEMDNKLDNVMILFRYLQEKDVFEKYFKQYLAKRLLLDKSCSDDVEKALLAKLKTECGCQFTQKLENMFRDKELWLTLATSFRDWREAQPTKMSIDISLRVLTAGVWPTVQCNPVVLPQELSVAYEMFTQYYTEKHTGRKLTINTLLGNADVKATFYPPPKASMSNEENGPGPSSSGESMKERKPEHKILQVNTHQMIILLQFNHHNRISCQQLMDELKIPERELKRNLQSLALGKASQRILVRKNKGKDAIDMSDEFAVNDNFQSKLTRVKVQMVTGKVESEPEIRETRQKVEDDRKLEVEAAIVRIMKARKKLNHNNLVAEVTQQLRHRFMPSPIIIKQRIETLIEREYLARDEHDHRAYQYIA 3D90A41092E540A7 nedd8_caeel NEDD8 Ubiquitin-like protein Nedd8 Neddylin Protein NED-8 ned-8 F45H11.2 protein protein caeel Caenorhabditis elegans MLIKVKTLTGKEIELDIEPNDRVERIKEKVEEKEGIPPPQQRLIFAGKQMNDDKTAADYKVLGGSVLHLVLALRGGF F3387DE33C671C78 q18986_caeel D2045.8 CELE_D2045.8 protein protein caeel Caenorhabditis elegans MEPSTIVKLDVGGKIFKTTIFTLCKHDSMLKTMFCTDVPVTKNEEGSVFIDRDSKHFRLILNFLRDGQIALPDSDREVREVLAEASYFLLDPLIELCGERLEQSLNPYYHLVSTVLEARKIIFATEKPIVVLRLPVYIATSGNQSYYFSETKFRELSEEYHKHVAFILITEPEFNEDCSWSFFLRAKKITARIKGPMDCNLVEECMQKLLKDAEKRRRGTKSFFNEIPMELVEHEELH 9FC99E68EDBE597B q965m5_caeel CELE_C17F4.8 C17F4.8 protein protein caeel Caenorhabditis elegans MCSKDNIVKLNVGGTVFQTSKSTLTMIDGFFKMMLESDIPLQKDDSNCIFIDRSPKHFDIILNFLRDGDVDLPEQEKEINEVKREAQFYLLEELVDLCHRKINTKIRVLISGTEKIEFYTKNDKPRLLIKYPEKNLDESPILDIDWGSLMEKYRDQFHIAFAPQNNCSLSANCQFKSVKSSIFLSIGDVSNDCEQFIDNFLKKHCGF 0666CD3AFC1BDA43 bat40_caeel BTB and MATH domain-containing protein 40 Y105E8B.4 bath-40 protein protein caeel Caenorhabditis elegans MSDRHLYGSDHSYLSSKPSCSSCRRQSSTSQKNECMTNPGSIVLTQRWTVCNFESLLKLSRPGSCLRSTVFKDDAVPDACWQLCLYPGGKREENANNVSLFLKMSATSPSKEVVLKAEYRFYFLDDNDEPKFSNVNVGEFHAKPPKGGHSWGLRNIPTQKVQNSIRQDKSLVISCHIELIPDASKVPCKRVPITPSIEMPFAQIPRAHVESELEMLASGDGTDMTIVAGPLDGEREQFRVHAYKLRAHSDVFQMMLSHTEMRENQEKRIEILDFSPTSVRAMVEFIYAGVIKSDIDVYQAVDVMQIAEKYQILALKMTCEQHLLDRLNVNNVLECITHAERYNTDVLYDACVDFAIHNRQHVMALTSWRNFISDEPVLASNLLEKMVKSNDNSSPPVKKPRV 0C181814BC97C115 p34808-2 Meiotic spindle formation protein mei-1 mei-1 Katanin p60 ATPase-containing subunit A1 p60 katanin T01G9.5 protein protein caeel Caenorhabditis elegans MNGDVQSVIRGYLERAQVAKTMSDAGRWNEAGDLLRQLMTDVKSCKISASNRDEHDARNTFLRALEANLKLVQQNVRDEDDLHEAMTRQSGSPEPPADPDVWSKPSPPLPSSSKFGATKKGVGAAGPRPREISKSTSSMSTNPADVKPANPTQGILPQNSAGDSFDASAYDAYIVQAVRGTMATNTENTMSLDDIIGMHDVKQVLHEAVTLPLLVPEFFQGLRSPWKAMVLAGPPGTGKTLIARAIASESSSTFFTVSSTDLSSKWRGDSEKIVRLLFELARFYAPSIIFIDEIDTLGGQRGNSGEHEASRRVKSEFLVQMDGSQNKFDSRRVFVLAATNIPWELDEALRRRFEKRIFIPLPDIDARKKLIEKSMEGTPKSDEINYDDLAARTEGFSGADVVSLCRTAAINVLRRYFRYDTKSLRGGELTAAMESLKAELVRNIDFEAALQAVSPSAGPDTMLKCKEWCDSFGAM No experimental confirmation available. F5EAF7893FF8FF99 q18776_caeel inso-1 C52B11.2 CELE_C52B11.2 protein protein caeel Caenorhabditis elegans MDTRKVSVSNTTSPRQSSDTEMSSSCATSTASAIDESDVRFSFQDTIQAIRHMSSNTDDSTNQNGVAAVKTNGFHYGSSSSSWVRLNVGGKVFQTTRSTLMREPCSFLYRLCQDEMGLPTDRDETGAYLIDRDPDFFSPILNYLRHGKLIMNPGLSEEGILAEADFYNLPSLSQLIMDRIQDRENSVKDATNKFVYRVLQCHEEELASVVSAMTDGWKIVQVVPINSNYTNYTTEQPQEYLCIVERECPDNGSMLEGQDRAKLLQQRARHN 72BD321863E12984 q94418_caeel CELE_ZK858.2 ZK858.2 protein protein caeel Caenorhabditis elegans MSSPSSASESDSSQMSLLATPPVAIRRPLPYPRDIISSPLEVATPVTVSPTDFMPIRELVTTPYHISTPVLITPVDARSISREIVRVNRIRRVRTRQASRSVFNSVRRRLSMITANRTEIQMNTPQTLPRSKRIDNTSTAMEPVSSNAFQKIISEILNNSPACTETINSTIIPSNSSNCAKLREFNRLESIGIAQMAVENENEILEALDFIEWNIRLMSCESDYIDKVLEDLENEKLNKQNKWERIELILSLIQD C4008A4CD978D6C7 bat41_caeel BTB and MATH domain-containing protein 41 F37A4.9 bath-41 protein protein caeel Caenorhabditis elegans MEINNGAQPENAAVSIPSRSPSGKSEKRKSPSIVSGCRTVMNERSFTNYWSVERFTVQLELHNPAEFMLAPKFGDGDYEFVMKLFPNGKDEETAGYLSLFLLINKCPNPRLRFRVSFTVETADGPRSCHLNKNLVTINRSGIVTASKFFSLDILRSAMNVYIPNDILTIGCELTIFGECTTQISSLFKPYQRTHSASSTSRSLSSPNTKCLKIDESSAHDAFTEFLSTGEFSDFIIVASCGREFPTHMCILAARSEYFKVLLRNHSTKEFMSKRLQFDDISARTLDVLLRHMYASAAGRVVKLEEDQLTEDLISAMDRLMINSLRDEVARLIGSKVTVDNVLTRISMAAELRLDDTYDVLLDFFSNHKHECMKLTAWDELESAKPPLAIKILRDAFSNTDSPSTTSMDSRIIDRITLT 365CEDED4034FD8C mel26_caeel Protein maternal effect lethal 26 ZK858.4 mel-26 protein protein caeel Caenorhabditis elegans MEPRIDGGVFIGGIGNSGNEMCSNGVPALGVSSQTEIKVEKVQHTWTVKNFSHCYQEYLENFVYLQRGDEQLTWSIKIYPKGNGENNKDFVFLCLNRVINNNVKAGKIGFKSQFKLRTAENKDIEMRIHPNPSHSDYVSYIKRDVLFPQIMPRDMIIVNVEIDVAVETITTTNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLTHQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATALLIAADKYRLEELKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTYILARPKNVTGTPGWEDILKGHPNLITDIFSQIDRQSSTGATSSVSNLPGVPMDIPGITGNIVPPPSGL 3AED944583A155AC bat15_caeel BTB and MATH domain-containing protein 15 C08C3.2 bath-15 protein protein caeel Caenorhabditis elegans MVAASKEFVFHHTFKDVSQLEDGDFFKSPEEIHYNAEWFILVIRTKDQLEAYLHCDNEKDDNVAWTVDAEFSLKIASSSGSYAMKFQKGCFDGFGLGWNDFVSWDSLTEDFLYDNSFTIEACVKITKMTGFSKDVLRSFDESEKRFSDVILVVGDEKFYVLKLFLASHSSYFNALFLGKFKEADQSEVTLQNIDPTDFQSLLEVLYGEPAIDDGTIDGVLLLAHMLDVTLAIRKCEEFLIEKSMKSMRELLKMANQYQLENLKTVCISKINTI F5F2F1457B77C5E1 o16612_caeel B0281.5 CELE_B0281.5 protein protein caeel Caenorhabditis elegans MSGNTVKLNVGGTVFETLKSTLTKHDGFFKALIETDVPAEKDDSNCFFIDRSPKHFETVLNYMRSGDVVLPDSKKDMLELKKEAEYYLLSNLAKLCQPPTDNFKTCTPEELMRVVANTDKKVIMINYLTYNGELVFYPWGFNLVHFLIQNRDYVEDVYFRRTESQYPEDGPFPNEKPYWTFLVYNSTRSGRRPFRHTVDLEDCMGHM 335B133334888D32 bat42_caeel BTB and MATH domain-containing protein 42 C50C3.8 bath-42 protein protein caeel Caenorhabditis elegans MSSRSSWSSTEQINRTISSRADDLPPQPRRLEVVSKQATRVTALSTKLEWKIEQFEKLMKLIKNGSNLISRMFSVPDAPTVCWELHVYPNGKRDEDVNNVSFFLRQVGLARGEEPIMTEFQIYALDANNQRVSVCRDTKDFTNQQGRGKFQVSRDKMLGALRSDGTLFLICEVEYFPPGSKISVEPVVDEDVSTEEQEEMPEVIVRANNRSMWEDELFTDCVIHVGNKHIKAHRCILGQNSPVFKSMFSSPNMIEAQKGEIHIEDAKYDSVRAMVEFMYTGATESLESQGNIDEILAIADKYEVLMLKDQCERLIAQTINLKNVTQIAMFSDTYTADYLKSAVIRFLTTHHRVVIKTQDWISLKKSRHELANELLEAVLSTDQDDDDVTSNIPISVSPPPARKRLRRSAK ED0E2ED32A0CDA3C p91563_caeel ZC239.15 CELE_ZC239.15 protein protein caeel Caenorhabditis elegans MSETVKLDVGGTIFKTSRSTLTKFNGFFKTMLESDIGLKIDESGSIFIDRSPKNFDLILNFMRDGDVVLPNCELKLKELLVEAQFYLLDGLIELCNSKIELVEAPKIKLRFIESDEQFLQILAVQQKPMLIIEFCMVGNDMSIPYNFNLYEFMEKYSHQFDIYFQRLSEDEPSRKWKARIKWKPTENGYYSQFPHNLRINRGGRIIRDATFLERLEKMIGEFDEYLKKQRNR 628709B60E08E50D o45593_caeel btb-20 CELE_F57C2.1 F57C2.1 protein protein caeel Caenorhabditis elegans MADEVIEYKFTCSSFYYGRETSQVLNTSITKGLKCVWKTRYASIAEQAFFSWEFDWNELKRLGIDSLAGNITVKSASMSPLNVQIDLRKPTEIVERAFYLRDDDYAYNSYINKTTFEYSFVPYCAQVDESLYEKMFLPSDENDAILVIGNKKLHVCKAFLSYHSSFFRAIFSSAFKEGQMSEIPIKDVTYKDFALMLSTIYPDAVFPNDRTVEKLLEMGDRFIIQSVINHVEYHLLHNTSIGNEKLMWMADRYGMPKLLVKSIQQMNSIEKAKALKSSPDYAKLSKEAKEKILDRLMALI DCF4AF4BF39CEAF3 cul3-016612 3 6 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association cul3-p91563 3 6 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association cul3-q18986 3 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association cul3-q965m5 3 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association cul3-q18776 3 6 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association cul3-q94418 3 13 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association cul3-p34371 3 18 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association cul3-q9nf14 3 6 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association cul3-p34324 3 16 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association cul3-o45593 3 6 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association cul3-p41886 3 14 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association cul3-p41886-1 2 14 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association cul3-16613-1 2 6 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association cul3-q18986-1 2 6 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association cul3-q18776-1 2 12 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait Q17391:p.Leu49Ala Leucine49alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 20:14:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu49ala' Tue Jun 30 17:39:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu49Ala' Q17391:p.Glu52Ala Glutamine52alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Wed May 02 16:22:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu52ala' Tue Jun 30 15:59:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu52Ala' gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association cul3-mel_26 2 6 unspecified role unspecified role bait bait Q17391:p.Leu49Ala Leucine49alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:57:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu49ala' Tue Jun 30 17:08:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu49Ala' Q17391:p.Glu52Ala Glutamine52alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Wed May 02 17:07:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu52ala' Tue Jun 30 17:55:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu52Ala' gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association cul3-p34371-1 2 6 unspecified role unspecified role bait bait Q17391:p.Leu49Ala Leucine49alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 19:13:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu49ala' Tue Jun 30 18:14:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu49Ala' Q17391:p.Glu52Ala Glutamine52alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Wed May 02 18:14:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu52ala' Tue Jun 30 15:38:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu52Ala' gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association cul3-q9nf14-1 2 6 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mel26-cul3 5 15 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association mei_1-mel_26-1 2 11 unspecified role unspecified role bait bait P34808-2:p.Pro99Leu Proline 99 Leucine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P L Wed May 02 15:31:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro99leu' Tue Jun 30 18:43:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro99Leu' gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q94420:p.Cys94Tyr Cysteine 94 Tyrosine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C Y Wed May 02 18:00:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys94tyr' Tue Jun 30 18:39:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys94Tyr' physical association physical association mei_1-mel_26-2 1 11 unspecified role unspecified role bait bait P34808-2:p.Pro99Leu Proline 99 Leucine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P L Wed May 02 17:01:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro99leu' Tue Jun 30 20:12:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro99Leu' 15 unspecified role unspecified role prey prey Q94420:p.Cys94Tyr Cysteine 94 Tyrosine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C Y Wed May 02 16:05:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys94tyr' Tue Jun 30 20:15:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys94Tyr' physical association physical association mei_1-mel_26-3 4 15 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association cul3-q18776-2 1 6 unspecified role unspecified role bait bait Q17391:p.Glu52Ala Glutamine52alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Wed May 02 15:38:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu52ala' Tue Jun 30 16:32:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu52Ala' Q17391:p.Leu49Ala Leucine49alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 20:20:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu49ala' Tue Jun 30 16:20:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu49Ala' 12 unspecified role unspecified role prey prey physical association physical association cul3-p34371-2 1 18 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait Q17391:p.Leu49Ala Leucine49alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:55:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu49ala' Tue Jun 30 15:53:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu49Ala' Q17391:p.Glu52Ala Glutamine52alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Wed May 02 18:08:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu52ala' Tue Jun 30 17:06:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu52Ala' physical association physical association cul3-mel_26-1 1 6 unspecified role unspecified role bait bait Q17391:p.Glu52Ala Glutamine52alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Wed May 02 15:26:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu52ala' Tue Jun 30 19:20:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu52Ala' Q17391:p.Leu49Ala Leucine49alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:13:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu49ala' Tue Jun 30 17:28:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu49Ala' 15 unspecified role unspecified role prey prey physical association physical association