MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it CD2AP/CMS regulates endosome morphology and traffic to the degradative pathway through its interaction with Rab4 and c-Cbl. CD2AP/CMS regulates endosome morphology and traffic to the degradative pathway through its interaction with Rab4 and c-Cbl. Traffic (1398-9219) 2003 Cormont M., Metón I., Mari M., Monzo P., Keslair F., Gaskin C., McGraw TE., Le Marchand-Brustel Y. cormont@unice.fr yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cormont M., Metón I., Mari M., Monzo P., Keslair F., Gaskin C., McGraw TE., Le Marchand-Brustel Y. cormont@unice.fr Traffic (1398-9219) 2003 CD2AP/CMS regulates endosome morphology and traffic to the degradative pathway through its interaction with Rab4 and c-Cbl. CD2AP/CMS regulates endosome morphology and traffic to the degradative pathway through its interaction with Rab4 and c-Cbl. Traffic (1398-9219) 2003 Cormont M., Metón I., Mari M., Monzo P., Keslair F., Gaskin C., McGraw TE., Le Marchand-Brustel Y. cormont@unice.fr in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cormont M., Metón I., Mari M., Monzo P., Keslair F., Gaskin C., McGraw TE., Le Marchand-Brustel Y. no cormont@unice.fr Traffic (1398-9219) 2003 cd2ap_mouse CD2-associated protein Mesenchyme-to-epithelium transition protein with SH3 domains 1 Cd2ap Mets1 protein protein mouse Mus musculus Mouse MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETEPKDDNLPIKRERQGNVASLVQRISTYGLPAGGIQPHPQTKAIKKKTKKRQCKVLFDYSPQNEDELELIVGDVIDVIEEVEEGWWSGTLNNKLGLFPSNFVKELESTEDGETHNAQEESEVPLTGPTSPLPSPGNGSEPAPGSVAQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKTEKPLILQPLGSRTQNVEVTKPDVDGKIKAKEYCRTLFPYTGTNEDELTFREGEIIHLISKETGEAGWWKGELNGKEGVFPDNFAVQISELDKDFPKPKKPPPPAKGPAPKPDLSAAEKKAFPLKAEEKDEKSLLEQKPSKPAAPQVPPKKPTAPTKASNLLRSPGAVYPKRPEKPVPPPPPAAKINGEVSIISSKIDTEPVSKPKLDPEQLPVRPKSVDLDAFVARNSKETDDVNFDDIASSENLLHLTANRPKMPGRRLPGRFNGGHSPTQSPEKTLKLPKEDDSGNLKPLEFKKDASYSSKSSLSTPSSASKVNTAAFLTPLELKAKAEADDGKRNSVDELRAQIIELLCIVDALKKDHGKELEKLRKELEEEKAMRSNLEVEIAKLKKAVLLS 0B618FE82AF12332 cbl_mouse E3 ubiquitin-protein ligase CBL Signal transduction protein CBL Proto-oncogene c-Cbl Casitas B-lineage lymphoma proto-oncogene Cbl RING-type E3 ubiquitin transferase CBL protein protein mouse Mus musculus Mouse MAGNVKKSSGAGGGGSGGSGAGGLIGLMKDAFQPHHHHHHLSPHPPCTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTVLSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDSLFMMKELAGAKVERPSSPFSMAPQASLPPVPPRLDLLQQRAPVPASTSVLGTASKAASGSLHKDKPLPIPPTLRDLPPPPPPDRPYSVGAETRPQRRPLPCTPGDCPSRDKLPPVPSSRPGDSWLSRPIPKVPVATPNPGDPWNGRELTNRHSLPFSLPSQMEPRADVPRLGSTFSLDTSMTMNSSPVAGPESEHPKIKPSSSANAIYSLAARPLPMPKLPPGEQGESEEDTEYMTPTSRPVGVQKPEPKRPLEATQSSRACDCDQQIDSCTYEAMYNIQSQALSVAENSASGEGNLATAHTSTGPEESENEDDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTNFNEGSQVPERPPKPFPRRINSERKASSYQQGGGATANPVATAPSPQLSSEIERLMSQGYSYQDIQKALVIAHNNIEMAKNILREFVSISSPAHVAT DIP protein P22682 original sequence version: 166 22F8A5C29F0262B8 rab4a_mouse Ras-related protein Rab-4A Rab4a Rab4 protein protein mouse Mus musculus Mouse MAQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVLILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFMQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRTQAPSAQECGC mint Protein transport. Probably involved in vesicular traffic E471820A506CDA01 rab4a-cd2ap 1 RAB4A 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 CD2AP 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-8595388]The shifted ranges (539-637) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-8595388]539-637 [EBI-8595388]Q9JLQ0,2 tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1B mint cd2ap-cd2ap 1 CD2AP 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-8595416]The shifted ranges (539-637) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-8595416]539-637 [EBI-8595416]Q9JLQ0,2 Stoichiometry: 1.0 CD2AP 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-8595422]The shifted ranges (539-637) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-8595422]539-637 [EBI-8595422]Q9JLQ0,2 tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association T1 homomint mint cd2ap-cbl-2 1 CD2AP 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 CBL 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-8595447]The shifted ranges (1-436) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-8595447]1-436 [EBI-8595447]P22682,2 tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association T1 homomint mint rab4a-cd2ap-1 2 RAB4A 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 CD2AP 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1C F1D mint rab4a-cd2ap-2 2 RAB4A 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 CD2AP 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction F1D mint