IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha. Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha. J. Biol. Chem. (0021-9258) 2002 Lim S., Jin K., Friedman E. Library - human skeletal muscle cDNA friedmae@mail.upstate.edu human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lim S., Jin K., Friedman E. Library - human skeletal muscle cDNA 6A friedmae@mail.upstate.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2002 Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha. Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha. J. Biol. Chem. (0021-9258) 2002 Lim S., Jin K., Friedman E. Library - human skeletal muscle cDNA friedmae@mail.upstate.edu in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lim S., Jin K., Friedman E. Library - human skeletal muscle cDNA 7 and 8 friedmae@mail.upstate.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2002 Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha. Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha. J. Biol. Chem. (0021-9258) 2002 Lim S., Jin K., Friedman E. Library - human skeletal muscle cDNA friedmae@mail.upstate.edu in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Lim S., Jin K., Friedman E. Library - human skeletal muscle cDNA 6B and 9 friedmae@mail.upstate.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2002 Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha. Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha. J. Biol. Chem. (0021-9258) 2002 Lim S., Jin K., Friedman E. Library - human skeletal muscle cDNA friedmae@mail.upstate.edu yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lim S., Jin K., Friedman E. Library - human skeletal muscle cDNA friedmae@mail.upstate.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2002 Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha. Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha. J. Biol. Chem. (0021-9258) 2002 Lim S., Jin K., Friedman E. Library - human skeletal muscle cDNA friedmae@mail.upstate.edu in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lim S., Jin K., Friedman E. Library - human skeletal muscle cDNA 2 friedmae@mail.upstate.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2002 dyr1b_human Dual specificity tyrosine-phosphorylation-regulated kinase 1B Mirk protein kinase Minibrain-related kinase DYRK1B MIRK protein protein human Homo sapiens Human MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHINEVYYAKKKRRAQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRTKELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGRPPLPPPDDPATLGPHLGLRGVPQSTAASS D7C354AC55943A8B phs2_human Pterin-4-alpha-carbinolamine dehydratase 2 4-alpha-hydroxy-tetrahydropterin dehydratase 2 DcoH-like protein DCoHm Dimerization cofactor of hepatocyte nuclear factor 1 from muscle HNF-1-alpha dimerization cofactor PCBD2 DCOH2 DCOHM protein protein human Homo sapiens Human MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV 7B834F95D7ACD1EE hnf1a_human Hepatocyte nuclear factor 1-alpha Liver-specific transcription factor LF-B1 HNF1A TCF1 Transcription factor 1 protein protein human Homo sapiens Human MVSKLSQLQTELLAALLESGLSKEALIQALGEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHKLAMDTYSGPPPGPGPGPALPAHSSPGLPPPALSPSKVHGVRYGQPATSETAEVPSSSGGPLVTVSTPLHQVSPTGLEPSHSLLSTEAKLVSAAGGPLPPVSTLTALHSLEQTSPGLNQQPQNLIMASLPGVMTIGPGEPASLGPTFTNTGASTLVIGLASTQAQSVPVINSMGSSLTTLQPVQFSQPLHPSYQQPLMPPVQSHVTQSPFMATMAQLQSPHALYSHKPEVAQYTHTGLLPQTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQSSDSSNGQSHLLPSNHSVIETFISTQMASSSQ DIP protein P20823 original sequence version: 113 8327CD4FDC39254A mp2k3_human Dual specificity mitogen-activated protein kinase kinase 3 MAPK/ERK kinase 3 MAP2K3 MEK3 MKK3 PRKMK3 SKK2 Stress-activated protein kinase kinase 2 protein protein human Homo sapiens Human MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS DIP protein P46734 original sequence version: 154 DIP protein P46734 original sequence version: 108 A80BA4FDFF8F75A2 dyrk1b-dcohm-1 4 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association dyrk1b-dcohm-2 5 7 unspecified role unspecified role prey prey in vitro In vitro 6 unspecified role unspecified role bait bait in vitro In vitro direct interaction direct interaction dyrk1b-map2k3-1 1 9 unspecified role unspecified role prey prey P46734:p.Thr222Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T E Wed May 02 16:30:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr222glu' Tue Jun 30 16:52:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr222Glu' P46734:p.Ser218Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E Wed May 02 19:05:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser218glu' Tue Jun 30 17:06:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser218Glu' 6 unspecified role unspecified role bait bait physical association physical association Residue numbering in paper suggests that isoform 1 of MAP2K3 is used in the experiment, but since this is not clear entry has been annotated to the parent protein dyrk1b-map2k3-2 3 6 enzyme target enzyme target substrate substrate unspecified role unspecified role human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 enzyme enzyme unspecified role unspecified role P46734:p.Thr222Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T E Wed May 02 19:46:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr222glu' Tue Jun 30 15:52:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr222Glu' P46734:p.Ser218Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E Wed May 02 19:54:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser218glu' Tue Jun 30 18:52:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser218Glu' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. phosphorylation phosphorylation reaction phosphorylation Residue numbering in paper suggests that isoform 1 of MAP2K3 is used in the experiment, but since this is not clear entry has been annotated to the parent protein dyrk1b-dcohm-3 2 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role prey prey s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association dyrk1b-tcf1-1 2 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction dyrk1b-tcf1-2 3 8 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 enzyme enzyme unspecified role unspecified role in vitro In vitro phosphorylation phosphorylation reaction phosphorylation Phosphorylation on Ser-249