IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A crystallographic view of interactions between Dbs and Cdc42: PH domain-assisted guanine nucleotide exchange. A crystallographic view of interactions between Dbs and Cdc42: PH domain-assisted guanine nucleotide exchange. EMBO J. (0261-4189) 2002 Rossman KL., Worthylake DK., Snyder JT., Siderovski DP., Campbell SL., Sondek J. in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Rossman KL., Worthylake DK., Snyder JT., Siderovski DP., Campbell SL., Sondek J. Nucleotide exchange of G proteins was followed by the increase of relative fluorescence due to the loading of a fluorescent GTP analogue (mant-GTP). The acceleration of the exchange after GEF (GTP exchange factor) addition was calculated. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2002 A crystallographic view of interactions between Dbs and Cdc42: PH domain-assisted guanine nucleotide exchange. A crystallographic view of interactions between Dbs and Cdc42: PH domain-assisted guanine nucleotide exchange. EMBO J. (0261-4189) 2002 Rossman KL., Worthylake DK., Snyder JT., Siderovski DP., Campbell SL., Sondek J. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Rossman KL., Worthylake DK., Snyder JT., Siderovski DP., Campbell SL., Sondek J. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). EMBO J. (0261-4189) 2002 q6pdm6_mouse Mcf2l protein protein mouse Mus musculus Mouse MALEEMVQRLNAVSKNTDEIMHQDIVPLCAADIQEQLKKRFAYLSGGRGQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRQDKWTSVKASVLRIAASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDEFKMKVPVMMLSSVPELHGYIDKSQLTEDLGGTLDYCHSRWLCHRTAIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVKEDLQLALKEGNSILESLREPLAESAAHSVNQDQLDNQATVQRLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFREVKTTLDSMSQKIAAFTDVGNSLAHVQHLLKDLTAFEEKSSVAVDKARALSLEGQQLIENRHYAVDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLETSMKWSDEGIFLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNEIYKEYECILNQDLLEHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPSPSPGSWRSSENSSSEGNALRRGPYRRAKSEMSEPRQGRTSSTGEEEESLAILRRHVMNELLDTERAYVEELLCVLEGYAAEMDNPLMAHLISTGLQNKKNILFGNMEEIYHFHNRIFLRELESCIDCPELVGRCFLERMEEFQIYEKYCQNKPRSESLWRQCSDCPFFQECQKKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSKHCEGAEDLQEALSSILGILKAVNDSMHLIAITGYDGNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLNMTAVGITENVKGDTKKFEIWYNAREEVYIIQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSHSLPLPTPSSTSPTKGNTRNVKKLEDRKTDPLSLEGYVSSSLPKPPEKGKDDAVPSSTSESSALSRKRFTLQGLANLKGQKASPTSPDKKAKRHEVKSDPTPFGLRGWSKTSHSLEAPEEDGGWSSAEELINSSDAEEDGGVGPKKLVPGKYTVVMDDEKGGPDTLAMRSGDMVEVVEEGAEGLWYVRDLTSSKEGWVPASSLSTLLGKSSSAQCLSSSGKIHCARQLCPEPAEILSPEPV D969135E4592F851 rhoa_human Transforming protein RhoA Rho cDNA clone 12 ARHA RHO12 RHOA ARH12 protein protein human Homo sapiens Human MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL DIP protein P61586 original sequence version: 86 DIP protein P61586 original sequence version: 123 DIP protein P61586 original sequence version: 57 DIP protein P61586 original sequence version: 88 DIP protein P61586 original sequence version: 87 DIP protein P61586 original sequence version: 85 DIP protein P61586 original sequence version: 125 DIP protein P61586 original sequence version: 132 C4DA2DC31FF858BC p60953-2 Cell division control protein 42 homolog CDC42 G25K GTP-binding protein Placental protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL DIP protein P60953-2 original sequence version: 152 DIP protein P60953 original sequence version: 98 DIP protein P60953 original sequence version: 148 DIP protein P60953 original sequence version: 142 DIP protein P60953-2 original sequence version: 135 DIP protein P60953 original sequence version: 99 DIP protein P60953-2 original sequence version: 139 DIP protein P60953 original sequence version: 144 DIP protein P60953 original sequence version: 163 DIP protein P60953 original sequence version: 158 DIP protein P60953-2 original sequence version: 147 DIP protein P60953 original sequence version: 123 51A437E22A4D8FFF mcf2l_mouse Guanine nucleotide exchange factor DBS DBL's big sister MCF2-transforming sequence-like protein Mcf2l Dbs protein protein mouse Mus musculus Mouse MSDCWCFIFCKEHVRSNPLSPQHDGASREEADHQVDVSDGIRLVPDKAEATAATASDEIMHQDIVPLCAADIQEQLKKRFAYLSGGRGQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRQDKWTSVKASVLRIAASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDEFKMKVPVMMLSSVPELHGYIDKSQLTEDLGGTLDYCHSRWLCHRTAIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVKEDLQLALKEGNSILESLREPLAESAAHSVNQDQLDNQATVQRLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFREVKTTLDSMSQKIAAFTDVGNSLAHVQHLLKDLTAFEEKSSVAVDKARALSLEGQQLIENRHYAVDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLETSMKWSDEGIFLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNEIYKEYECILNQDLLEHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPSPSPGSWRSSENSSSEGNALRRGPYRRAKSEMSEPRQGRTSSTGEEEESLAILRRHVMNELLDTERAYVEELLCVLEGYAAEMDNPLMAHLISTGLQNKKNILFGNMEEIYHFHNRNIPAGLESCIDCPELVGRCFLERMEEFQIYEKYCQNKPRSESLWRQCSDCPFFQECQKKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSKHCEGAEDLQEALSSILGILKAVNDSMHLIAITGYDGNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLNMTAVGITENVKGDTKKFEIWYNAREEVYIIQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSHSLPLPTPSSTSPTKGNTRNVKKLEDRKTDPLSLEGYVSSSLPKPPEKGKGWSKTSHSLEAPEEDGGWSSAEELINSSDAEEDGGVGPKKLVPGKYTVVMDDEKGGPDTLAMRSGDMVEVVEEGAEGLWYVRDLTSSKEGWVPASSLSTLLGKSSSAQCLSSSGKIHCARQLCPEPAEILSPEPV DIP protein Q64096 original sequence version: 120 0A325FB42E49BA6D cdc42-dbs-1 2 6 unspecified role unspecified role neutral component neutral component dh-ph binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P60953-2:p.Cys188Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Thu Jul 07 12:18:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys188ser Wed May 02 19:12:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys188ser' Tue Jun 30 16:57:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys188Ser' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2.40A working 19.7%, free 23.9% The Dbs sequence used is identical to P61586 which may be a splice isoform of Dbs (Q64096). The cysteine 188 of cdc42 which can be modified (S-geranylgeranyl cysteine) in eukaryote is mutated in Serine and the following amino-acids normally cleaved in the modification process are not in the produced protein. cdc42-dbs-2 2 6 unspecified role unspecified role neutral component neutral component c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range dh-ph binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q64096:p.Tyr889Phe mutation mutation certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:16:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr889phe' Tue Jun 30 18:27:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr889Phe' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P60953-2:p.Cys188Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Thu Jul 07 12:18:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys188ser Wed May 02 15:30:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys188ser' Tue Jun 30 19:29:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys188Ser' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2.60A working 21.7%, free 25.9% The Dbs sequence used is identical to P61586 which may be a splice isoform of Dbs (Q64096). The cysteine 188 of cdc42 which can be modified (S-geranylgeranyl cysteine) in eucaryote is mutated in Serine and the following amino-acids normally cleaved in the modification process are not in the produced protein. Y889F mutation in Dbs allows complex formation but impairs nucleotide exchange. cdc42-dbs-3 1 6 unspecified role unspecified role neutral component neutral component c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range dh-ph binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q64096:p.His814Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain H A Wed May 02 16:08:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his814ala' Tue Jun 30 18:15:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His814Ala' Q64096:p.Tyr889Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 17:14:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr889phe' Tue Jun 30 15:44:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr889Phe' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P60953-2:p.Cys188Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Thu Jul 07 12:17:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys188ser Wed May 02 16:44:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys188ser' Tue Jun 30 15:50:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys188Ser' ecoli Escherichia coli (strain K12) physical association physical association The Dbs sequence used is identical to P61586 which may be a splice isoform of Dbs (Q64096). The cysteine 188 of cdc42 which can be modified (S-geranylgeranyl cysteine) in eucaryote is mutated in Serine and the following amino-acids normally cleaved in the modification process are not in the produced protein. The intrinsic nucleotide exchange rate of Cdc42 is 0.28 s-1. The nucleotide exchange rate of Cdc42 is accelerated if catalyzed by Dbs and the increase fold depends on the Dbs fragment used. With DH-PH WT Dbs fragment, it is 15.49 s-1 (57 fold). With DH-PH Y889F Dbs fragment, it is 1.98 s-1 (7 fold). With DH-PH H814A Dbs fragment, it is 1.22 s-1 (4 fold). With DH WT Dbs fragment, it is only = 1.42 s-1 (5 fold). rhoa-dbs-3 1 3 enzyme enzyme unspecified role unspecified role dh-ph binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecobb Escherichia coli (strain B / BL21) 4 enzyme target enzyme target substrate substrate unspecified role unspecified role P61586:p.Cys190Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Thu Jul 07 12:17:46 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys190ser Wed May 02 15:36:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys190ser' Tue Jun 30 19:04:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys190Ser' region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association The cysteine 190 of RhoA which can be modified (S-geranylgeranyl cysteine)in eucaryote is mutated in Serine and the following amino-acids normally cleaved in the modification process are not in the produced protein. The Dbs sequence used is identical to P61586 which may be a splice isoform of Dbs (Q64096). nucleotide exchange rate: intrinsic= 0.16 s-1, +WT Dbs DH-PH = 4.11 s-1 (26 fold), + Y889 Dbs = 0.43 s-1(3 fold), + H814A Dbs = 0.25 s-1(2 fold), +WT Dbs DH only = 0.17 s-1(1 fold)